KEGG   Homo sapiens (human): 3691Help
Entry
3691              CDS       T01001                                 

Gene name
ITGB4, CD104
Definition
integrin, beta 4
Orthology
K06525  
integrin beta 4
Organism
hsa  Homo sapiens (human)
Pathway
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Regulation of actin cytoskeleton
Hypertrophic cardiomyopathy (HCM)
Arrhythmogenic right ventricular cardiomyopathy (ARVC)
Dilated cardiomyopathy
Disease
H00586  
Epidermolysis bullosa, junctional
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    3691 (ITGB4)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    3691 (ITGB4)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    3691 (ITGB4)
  Cell communication
   04510 Focal adhesion
    3691 (ITGB4)
 Human Diseases
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    3691 (ITGB4)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    3691 (ITGB4)
   05414 Dilated cardiomyopathy (DCM)
    3691 (ITGB4)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   3691 (ITGB4)
  Exosomal proteins of bladder cancer cells
   3691 (ITGB4)
Cellular antigens [BR:hsa04090]
 Proteins
  3691 (ITGB4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
17q25
AA seq 1822 aa AA seqDB search
MAGPRPSPWARLLLAALISVSLSGTLANRCKKAPVKSCTECVRVDKDCAYCTDEMFRDRR
CNTQAELLAAGCQRESIVVMESSFQITEETQIDTTLRRSQMSPQGLRVRLRPGEERHFEL
EVFEPLESPVDLYILMDFSNSMSDDLDNLKKMGQNLARVLSQLTSDYTIGFGKFVDKVSV
PQTDMRPEKLKEPWPNSDPPFSFKNVISLTEDVDEFRNKLQGERISGNLDAPEGGFDAIL
QTAVCTRDIGWRPDSTHLLVFSTESAFHYEADGANVLAGIMSRNDERCHLDTTGTYTQYR
TQDYPSVPTLVRLLAKHNIIPIFAVTNYSYSYYEKLHTYFPVSSLGVLQEDSSNIVELLE
EAFNRIRSNLDIRALDSPRGLRTEVTSKMFQKTRTGSFHIRRGEVGIYQVQLRALEHVDG
THVCQLPEDQKGNIHLKPSFSDGLKMDAGIICDVCTCELQKEVRSARCSFNGDFVCGQCV
CSEGWSGQTCNCSTGSLSDIQPCLREGEDKPCSGRGECQCGHCVCYGEGRYEGQFCEYDN
FQCPRTSGFLCNDRGRCSMGQCVCEPGWTGPSCDCPLSNATCIDSNGGICNGRGHCECGR
CHCHQQSLYTDTICEINYSAIHPGLCEDLRSCVQCQAWGTGEKKGRTCEECNFKVKMVDE
LKRAEEVVVRCSFRDEDDDCTYSYTMEGDGAPGPNSTVLVHKKKDCPPGSFWWLIPLLLL
LLPLLALLLLLCWKYCACCKACLALLPCCNRGHMVGFKEDHYMLRENLMASDHLDTPMLR
SGNLKGRDVVRWKVTNNMQRPGFATHAASINPTELVPYGLSLRLARLCTENLLKPDTREC
AQLRQEVEENLNEVYRQISGVHKLQQTKFRQQPNAGKKQDHTIVDTVLMAPRSAKPALLK
LTEKQVEQRAFHDLKVAPGYYTLTADQDARGMVEFQEGVELVDVRVPLFIRPEDDDEKQL
LVEAIDVPAGTATLGRRLVNITIIKEQARDVVSFEQPEFSVSRGDQVARIPVIRRVLDGG
KSQVSYRTQDGTAQGNRDYIPVEGELLFQPGEAWKELQVKLLELQEVDSLLRGRQVRRFH
VQLSNPKFGAHLGQPHSTTIIIRDPDELDRSFTSQMLSSQPPPHGDLGAPQNPNAKAAGS
RKIHFNWLPPSGKPMGYRVKYWIQGDSESEAHLLDSKVPSVELTNLYPYCDYEMKVCAYG
AQGEGPYSSLVSCRTHQEVPSEPGRLAFNVVSSTVTQLSWAEPAETNGEITAYEVCYGLV
NDDNRPIGPMKKVLVDNPKNRMLLIENLRESQPYRYTVKARNGAGWGPEREAIINLATQP
KRPMSIPIIPDIPIVDAQSGEDYDSFLMYSDDVLRSPSGSQRPSVSDDTGCGWKFEPLLG
EELDLRRVTWRLPPELIPRLSASSGRSSDAEAPHGPPDDGGAGGKGGSLPRSATPGPPGE
HLVNGRMDFAFPGSTNSLHRMTTTSAAAYGTHLSPHVPHRVLSTSSTLTRDYNSLTRSEH
SHSTTLPRDYSTLTSVSSHDSRLTAGVPDTPTRLVFSALGPTSLRVSWQEPRCERPLQGY
SVEYQLLNGGELHRLNIPNPAQTSVVVEDLLPNHSYVFRVRAQSQEGWGREREGVITIES
QVHPQSPLCPLPGSAFTLSTPSAPGPLVFTALSPDSLQLSWERPRRPNGDIVGYLVTCEM
AQGGGPATAFRVDGDSPESRLTVPGLSENVPYKFKVQARTTEGFGPEREGIITIESQDGG
PFPQLGSRAGLFQHPLQSEYSSITTTHTSATEPFLVDGLTLGAQHLEAGGSLTRHVTQEF
VSRTLTTSGTLSTHMDQQFFQT
NT seq 5469 nt NT seq  +upstreamnt  +downstreamnt
atggcagggccacgccccagcccatgggccaggctgctcctggcagccttgatcagcgtc
agcctctctgggaccttggcaaaccgctgcaagaaggccccagtgaagagctgcacggag
tgtgtccgtgtggataaggactgcgcctactgcacagacgagatgttcagggaccggcgc
tgcaacacccaggcggagctgctggccgcgggctgccagcgggagagcatcgtggtcatg
gagagcagcttccaaatcacagaggagacccagattgacaccaccctgcggcgcagccag
atgtccccccaaggcctgcgggtccgtctgcggcccggtgaggagcggcattttgagctg
gaggtgtttgagccactggagagccccgtggacctgtacatcctcatggacttctccaac
tccatgtccgatgatctggacaacctcaagaagatggggcagaacctggctcgggtcctg
agccagctcaccagcgactacactattggatttggcaagtttgtggacaaagtcagcgtc
ccgcagacggacatgaggcctgagaagctgaaggagccctggcccaacagtgaccccccc
ttctccttcaagaacgtcatcagcctgacagaagatgtggatgagttccggaataaactg
cagggagagcggatctcaggcaacctggatgctcctgagggcggcttcgatgccatcctg
cagacagctgtgtgcacgagggacattggctggcgcccggacagcacccacctgctggtc
ttctccaccgagtcagccttccactatgaggctgatggcgccaacgtgctggctggcatc
atgagccgcaacgatgaacggtgccacctggacaccacgggcacctacacccagtacagg
acacaggactacccgtcggtgcccaccctggtgcgcctgctcgccaagcacaacatcatc
cccatctttgctgtcaccaactactcctatagctactacgagaagcttcacacctatttc
cctgtctcctcactgggggtgctgcaggaggactcgtccaacatcgtggagctgctggag
gaggccttcaatcggatccgctccaacctggacatccgggccctagacagcccccgaggc
cttcggacagaggtcacctccaagatgttccagaagacgaggactgggtcctttcacatc
cggcggggggaagtgggtatataccaggtgcagctgcgggcccttgagcacgtggatggg
acgcacgtgtgccagctgccggaggaccagaagggcaacatccatctgaaaccttccttc
tccgacggcctcaagatggacgcgggcatcatctgtgatgtgtgcacctgcgagctgcaa
aaagaggtgcggtcagctcgctgcagcttcaacggagacttcgtgtgcggacagtgtgtg
tgcagcgagggctggagtggccagacctgcaactgctccaccggctctctgagtgacatt
cagccctgcctgcgggagggcgaggacaagccgtgctccggccgtggggagtgccagtgc
gggcactgtgtgtgctacggcgaaggccgctacgagggtcagttctgcgagtatgacaac
ttccagtgtccccgcacttccgggttcctctgcaatgaccgaggacgctgctccatgggc
cagtgtgtgtgtgagcctggttggacaggcccaagctgtgactgtcccctcagcaatgcc
acctgcatcgacagcaatgggggcatctgtaatggacgtggccactgtgagtgtggccgc
tgccactgccaccagcagtcgctctacacggacaccatctgcgagatcaactactcggcg
atccacccgggcctctgcgaggacctacgctcctgcgtgcagtgccaggcgtggggcacc
ggcgagaagaaggggcgcacgtgtgaggaatgcaacttcaaggtcaagatggtggacgag
cttaagagagccgaggaggtggtggtgcgctgctccttccgggacgaggatgacgactgc
acctacagctacaccatggaaggtgacggcgcccctgggcccaacagcactgtcctggtg
cacaagaagaaggactgccctccgggctccttctggtggctcatccccctgctcctcctc
ctcctgccgctcctggccctgctactgctgctatgctggaagtactgtgcctgctgcaag
gcctgcctggcacttctcccgtgctgcaaccgaggtcacatggtgggctttaaggaagac
cactacatgctgcgggagaacctgatggcctctgaccacttggacacgcccatgctgcgc
agcgggaacctcaagggccgtgacgtggtccgctggaaggtcaccaacaacatgcagcgg
cctggctttgccactcatgccgccagcatcaaccccacagagctggtgccctacgggctg
tccttgcgcctggcccgcctttgcaccgagaacctgctgaagcctgacactcgggagtgc
gcccagctgcgccaggaggtggaggagaacctgaacgaggtctacaggcagatctccggt
gtacacaagctccagcagaccaagttccggcagcagcccaatgccgggaaaaagcaagac
cacaccattgtggacacagtgctgatggcgccccgctcggccaagccggccctgctgaag
cttacagagaagcaggtggaacagagggccttccacgacctcaaggtggcccccggctac
tacaccctcactgcagaccaggacgcccggggcatggtggagttccaggagggcgtggag
ctggtggacgtacgggtgcccctctttatccggcctgaggatgacgacgagaagcagctg
ctggtggaggccatcgacgtgcccgcaggcactgccaccctcggccgccgcctggtaaac
atcaccatcatcaaggagcaagccagagacgtggtgtcctttgagcagcctgagttctcg
gtcagccgcggggaccaggtggcccgcatccctgtcatccggcgtgtcctggacggcggg
aagtcccaggtctcctaccgcacacaggatggcaccgcgcagggcaaccgggactacatc
cccgtggagggtgagctgctgttccagcctggggaggcctggaaagagctgcaggtgaag
ctcctggagctgcaagaagttgactccctcctgcggggccgccaggtccgccgtttccac
gtccagctcagcaaccctaagtttggggcccacctgggccagccccactccaccaccatc
atcatcagggacccagatgaactggaccggagcttcacgagtcagatgttgtcatcacag
ccaccccctcacggcgacctgggcgccccgcagaaccccaatgctaaggccgctgggtcc
aggaagatccatttcaactggctgcccccttctggcaagccaatggggtacagggtaaag
tactggattcagggtgactccgaatccgaagcccacctgctcgacagcaaggtgccctca
gtggagctcaccaacctgtacccgtattgcgactatgagatgaaggtgtgcgcctacggg
gctcagggcgagggaccctacagctccctggtgtcctgccgcacccaccaggaagtgccc
agcgagccagggcgtctggccttcaatgtcgtctcctccacggtgacccagctgagctgg
gctgagccggctgagaccaacggtgagatcacagcctacgaggtctgctatggcctggtc
aacgatgacaaccgacctattgggcccatgaagaaagtgctggttgacaaccctaagaac
cggatgctgcttattgagaaccttcgggagtcccagccctaccgctacacggtgaaggcg
cgcaacggggccggctgggggcctgagcgggaggccatcatcaacctggccacccagccc
aagaggcccatgtccatccccatcatccctgacatccctatcgtggacgcccagagcggg
gaggactacgacagcttccttatgtacagcgatgacgttctacgctctccatcgggcagc
cagaggcccagcgtctccgatgacactggctgcggctggaagttcgagcccctgctgggg
gaggagctggacctgcggcgcgtcacgtggcggctgcccccggagctcatcccgcgcctg
tcggccagcagcgggcgctcctccgacgccgaggcgccccacgggcccccggacgacggc
ggcgcgggcgggaagggcggcagcctgccccgcagtgcgacacccgggccccccggagag
cacctggtgaatggccggatggactttgccttcccgggcagcaccaactccctgcacagg
atgaccacgaccagtgctgctgcctatggcacccacctgagcccacacgtgccccaccgc
gtgctaagcacatcctccaccctcacacgggactacaactcactgacccgctcagaacac
tcacactcgaccacactgcccagggactactccaccctcacctccgtctcctcccacgac
tctcgcctgactgctggtgtgcccgacacgcccacccgcctggtgttctctgccctgggg
cccacatctctcagagtgagctggcaggagccgcggtgcgagcggccgctgcagggctac
agtgtggagtaccagctgctgaacggcggtgagctgcatcggctcaacatccccaaccct
gcccagacctcggtggtggtggaagacctcctgcccaaccactcctacgtgttccgcgtg
cgggcccagagccaggaaggctggggccgagagcgtgagggtgtcatcaccattgaatcc
caggtgcacccgcagagcccactgtgtcccctgccaggctccgccttcactttgagcact
cccagtgccccaggcccgctggtgttcactgccctgagcccagactcgctgcagctgagc
tgggagcggccacggaggcccaatggggatatcgtcggctacctggtgacctgtgagatg
gcccaaggaggagggccagccaccgcattccgggtggatggagacagccccgagagccgg
ctgaccgtgccgggcctcagcgagaacgtgccctacaagttcaaggtgcaggccaggacc
actgagggcttcgggccagagcgcgagggcatcatcaccatagagtcccaggatggagga
cccttcccgcagctgggcagccgtgccgggctcttccagcacccgctgcaaagcgagtac
agcagcatcaccaccacccacaccagcgccaccgagcccttcctagtggatgggctgacc
ctgggggcccagcacctggaggcaggcggctccctcacccggcatgtgacccaggagttt
gtgagccggacactgaccaccagcggaacccttagcacccacatggaccaacagttcttc
caaacttga

DBGET integrated database retrieval system