KEGG   Homo sapiens (human): 3693Help
Entry
3693              CDS       T01001                                 

Gene name
ITGB5
Definition
(RefSeq) integrin subunit beta 5
  KO
K06588  integrin beta 5
Organism
hsa  Homo sapiens (human)
Pathway
hsa04145  Phagosome
hsa04151  PI3K-Akt signaling pathway
hsa04510  Focal adhesion
hsa04512  ECM-receptor interaction
hsa04810  Regulation of actin cytoskeleton
hsa05165  Human papillomavirus infection
hsa05205  Proteoglycans in cancer
hsa05410  Hypertrophic cardiomyopathy (HCM)
hsa05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
hsa05414  Dilated cardiomyopathy (DCM)
Drug target
Cilengitide: D03497
Fluciclatide F 18: D09903
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    3693 (ITGB5)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    3693 (ITGB5)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    3693 (ITGB5)
  Cellular community - eukaryotes
   04510 Focal adhesion
    3693 (ITGB5)
  Cell motility
   04810 Regulation of actin cytoskeleton
    3693 (ITGB5)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    3693 (ITGB5)
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    3693 (ITGB5)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    3693 (ITGB5)
   05414 Dilated cardiomyopathy (DCM)
    3693 (ITGB5)
  Infectious diseases
   05165 Human papillomavirus infection
    3693 (ITGB5)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Phagocytosis
   Integrins (complement receptors)
    3693 (ITGB5)
Cell adhesion molecules [BR:hsa04515]
 Integrins
  Integrin beta subunits
   3693 (ITGB5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Integrin_beta Integrin_b_cyt Integrin_B_tail PSI_integrin EGF_2 DUF2975
Motif
Other DBs
NCBI-GeneID: 3693
NCBI-ProteinID: NP_002204
OMIM: 147561
HGNC: 6160
Ensembl: ENSG00000082781
Vega: OTTHUMG00000159432
Pharos: P18084(Tbio)
UniProt: P18084 L7RT22
Position
3q21.2
AA seq 799 aa AA seqDB search
MPRAPAPLYACLLGLCALLPRLAGLNICTSGSATSCEECLLIHPKCAWCSKEDFGSPRSI
TSRCDLRANLVKNGCGGEIESPASSFHVLRSLPLSSKGSGSAGWDVIQMTPQEIAVNLRP
GDKTTFQLQVRQVEDYPVDLYYLMDLSLSMKDDLDNIRSLGTKLAEEMRKLTSNFRLGFG
SFVDKDISPFSYTAPRYQTNPCIGYKLFPNCVPSFGFRHLLPLTDRVDSFNEEVRKQRVS
RNRDAPEGGFDAVLQAAVCKEKIGWRKDALHLLVFTTDDVPHIALDGKLGGLVQPHDGQC
HLNEANEYTASNQMDYPSLALLGEKLAENNINLIFAVTKNHYMLYKNFTALIPGTTVEIL
DGDSKNIIQLIINAYNSIRSKVELSVWDQPEDLNLFFTATCQDGVSYPGQRKCEGLKIGD
TASFEVSLEARSCPSRHTEHVFALRPVGFRDSLEVGVTYNCTCGCSVGLEPNSARCNGSG
TYVCGLCECSPGYLGTRCECQDGENQSVYQNLCREAEGKPLCSGRGDCSCNQCSCFESEF
GKIYGPFCECDNFSCARNKGVLCSGHGECHCGECKCHAGYIGDNCNCSTDISTCRGRDGQ
ICSERGHCLCGQCQCTEPGAFGEMCEKCPTCPDACSTKRDCVECLLLHSGKPDNQTCHSL
CRDEVITWVDTIVKDDQEAVLCFYKTAKDCVMMFTYVELPSGKSNLTVLREPECGNTPNA
MTILLAVVGSILLVGLALLAIWKLLVTIHDRREFAKFQSERSRARYEMASNPLYRKPIST
HTVDFTFNKFNKSYNGTVD
NT seq 2400 nt NT seq  +upstreamnt  +downstreamnt
atgccgcgggccccggcgccgctgtacgcctgcctcctggggctctgcgcgctcctgccc
cggctcgcaggtctcaacatatgcactagtggaagtgccacctcatgtgaagaatgtctg
ctaatccacccaaaatgtgcctggtgctccaaagaggacttcggaagcccacggtccatc
acctctcggtgtgatctgagggcaaaccttgtcaaaaatggctgtggaggtgagatagag
agcccagccagcagcttccatgtcctgaggagcctgcccctcagcagcaagggttcgggc
tctgcaggctgggacgtcattcagatgacaccacaggagattgccgtgaacctccggccc
ggtgacaagaccaccttccagctacaggttcgccaggtggaggactatcctgtggacctg
tactacctgatggacctctccctgtccatgaaggatgacttggacaatatccggagcctg
ggcaccaaactcgcggaggagatgaggaagctcaccagcaacttccggttgggatttggg
tcttttgttgataaggacatctctcctttctcctacacggcaccgaggtaccagaccaat
ccgtgcattggttacaagttgtttccaaattgcgtcccctcctttgggttccgccatctg
ctgcctctcacagacagagtggacagcttcaatgaggaagttcggaaacagagggtgtcc
cggaaccgagatgcccctgaggggggctttgatgcagtactccaggcagccgtctgcaag
gagaagattggctggcgaaaggatgcactgcatttgctggtgttcacaacagatgatgtg
ccccacatcgcattggatggaaaattgggaggcctggtgcagccacacgatggccagtgc
cacctgaacgaggccaacgagtacactgcatccaaccagatggactatccatcccttgcc
ttgcttggagagaaattggcagagaacaacatcaacctcatctttgcagtgacaaaaaac
cattatatgctgtacaagaattttacagccctgatacctggaacaacggtggagatttta
gatggagactccaaaaatattattcaactgattattaatgcatacaatagtatccggtct
aaagtggagttgtcagtctgggatcagcctgaggatcttaatctcttctttactgctacc
tgccaagatggggtatcctatcctggtcagaggaagtgtgagggtctgaagattggggac
acggcatcttttgaagtatcattggaggcccgaagctgtcccagcagacacacggagcat
gtgtttgccctgcggccggtgggattccgggacagcctggaggtgggggtcacctacaac
tgcacgtgcggctgcagcgtggggctggaacccaacagcgccaggtgcaacgggagcggg
acctatgtctgcggcctgtgtgagtgcagccccggctacctgggcaccaggtgcgagtgc
caggatggggagaaccagagcgtgtaccagaacctgtgccgggaggcagagggcaagcca
ctgtgcagcgggcgtggggactgcagctgcaaccagtgctcctgcttcgagagcgagttt
ggcaagatctatgggcctttctgtgagtgcgacaacttctcctgtgccaggaacaaggga
gtcctctgctcaggccatggcgagtgtcactgcggggaatgcaagtgccatgcaggttac
atcggggacaactgtaactgctcgacagacatcagcacatgccggggcagagatggccag
atctgcagcgagcgtgggcactgtctctgtgggcagtgccaatgcacggagccgggggcc
tttggggagatgtgtgagaagtgccccacctgcccggatgcatgcagcaccaagagagat
tgcgtcgagtgcctgctgctccactctgggaaacctgacaaccagacctgccacagccta
tgcagggatgaggtgatcacatgggtggacaccatcgtgaaagatgaccaggaggctgtg
ctatgtttctacaaaaccgccaaggactgcgtcatgatgttcacctatgtggagctcccc
agtgggaagtccaacctgaccgtcctcagggagccagagtgtggaaacacccccaacgcc
atgaccatcctcctggctgtggtcggtagcatcctccttgttgggcttgcactcctggct
atctggaagctgcttgtcaccatccacgaccggagggagtttgcaaagtttcagagcgag
cgatccagggcccgctatgaaatggcttcaaatccattatacagaaagcctatctccacg
cacactgtggacttcaccttcaacaagttcaacaaatcctacaatggcactgtggactga

DBGET integrated database retrieval system