KEGG   Homo sapiens (human): 3693Help
Entry
3693              CDS       T01001                                 

Gene name
ITGB5
Definition
integrin, beta 5
Orthology
K06588  
integrin beta 5
Organism
hsa  Homo sapiens (human)
Pathway
Phagosome
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Regulation of actin cytoskeleton
Proteoglycans in cancer
Hypertrophic cardiomyopathy (HCM)
Arrhythmogenic right ventricular cardiomyopathy (ARVC)
Dilated cardiomyopathy
Drug target
Other: 
Class
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:hsa04151]
Environmental Information Processing; Signaling molecules and interaction; ECM-receptor interaction [PATH:hsa04512]
Cellular Processes; Transport and catabolism; Phagosome [PATH:hsa04145]
Cellular Processes; Cell motility; Regulation of actin cytoskeleton [PATH:hsa04810]
Cellular Processes; Cell communication; Focal adhesion [PATH:hsa04510]
Human Diseases; Cancers; Proteoglycans in cancer [PATH:hsa05205]
Human Diseases; Cardiovascular diseases; Hypertrophic cardiomyopathy (HCM) [PATH:hsa05410]
Human Diseases; Cardiovascular diseases; Arrhythmogenic right ventricular cardiomyopathy (ARVC) [PATH:hsa05412]
Human Diseases; Cardiovascular diseases; Dilated cardiomyopathy (DCM) [PATH:hsa05414]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
3q21.2
AA seq 799 aa AA seqDB search
MPRAPAPLYACLLGLCALLPRLAGLNICTSGSATSCEECLLIHPKCAWCSKEDFGSPRSI
TSRCDLRANLVKNGCGGEIESPASSFHVLRSLPLSSKGSGSAGWDVIQMTPQEIAVNLRP
GDKTTFQLQVRQVEDYPVDLYYLMDLSLSMKDDLDNIRSLGTKLAEEMRKLTSNFRLGFG
SFVDKDISPFSYTAPRYQTNPCIGYKLFPNCVPSFGFRHLLPLTDRVDSFNEEVRKQRVS
RNRDAPEGGFDAVLQAAVCKEKIGWRKDALHLLVFTTDDVPHIALDGKLGGLVQPHDGQC
HLNEANEYTASNQMDYPSLALLGEKLAENNINLIFAVTKNHYMLYKNFTALIPGTTVEIL
DGDSKNIIQLIINAYNSIRSKVELSVWDQPEDLNLFFTATCQDGVSYPGQRKCEGLKIGD
TASFEVSLEARSCPSRHTEHVFALRPVGFRDSLEVGVTYNCTCGCSVGLEPNSARCNGSG
TYVCGLCECSPGYLGTRCECQDGENQSVYQNLCREAEGKPLCSGRGDCSCNQCSCFESEF
GKIYGPFCECDNFSCARNKGVLCSGHGECHCGECKCHAGYIGDNCNCSTDISTCRGRDGQ
ICSERGHCLCGQCQCTEPGAFGEMCEKCPTCPDACSTKRDCVECLLLHSGKPDNQTCHSL
CRDEVITWVDTIVKDDQEAVLCFYKTAKDCVMMFTYVELPSGKSNLTVLREPECGNTPNA
MTILLAVVGSILLVGLALLAIWKLLVTIHDRREFAKFQSERSRARYEMASNPLYRKPIST
HTVDFTFNKFNKSYNGTVD
NT seq 2400 nt NT seq  +upstreamnt  +downstreamnt
atgccgcgggccccggcgccgctgtacgcctgcctcctggggctctgcgcgctcctgccc
cggctcgcaggtctcaacatatgcactagtggaagtgccacctcatgtgaagaatgtctg
ctaatccacccaaaatgtgcctggtgctccaaagaggacttcggaagcccacggtccatc
acctctcggtgtgatctgagggcaaaccttgtcaaaaatggctgtggaggtgagatagag
agcccagccagcagcttccatgtcctgaggagcctgcccctcagcagcaagggttcgggc
tctgcaggctgggacgtcattcagatgacaccacaggagattgccgtgaacctccggccc
ggtgacaagaccaccttccagctacaggttcgccaggtggaggactatcctgtggacctg
tactacctgatggacctctccctgtccatgaaggatgacttggacaatatccggagcctg
ggcaccaaactcgcggaggagatgaggaagctcaccagcaacttccggttgggatttggg
tcttttgttgataaggacatctctcctttctcctacacggcaccgaggtaccagaccaat
ccgtgcattggttacaagttgtttccaaattgcgtcccctcctttgggttccgccatctg
ctgcctctcacagacagagtggacagcttcaatgaggaagttcggaaacagagggtgtcc
cggaaccgagatgcccctgaggggggctttgatgcagtactccaggcagccgtctgcaag
gagaagattggctggcgaaaggatgcactgcatttgctggtgttcacaacagatgatgtg
ccccacatcgcattggatggaaaattgggaggcctggtgcagccacacgatggccagtgc
cacctgaacgaggccaacgagtacactgcatccaaccagatggactatccatcccttgcc
ttgcttggagagaaattggcagagaacaacatcaacctcatctttgcagtgacaaaaaac
cattatatgctgtacaagaattttacagccctgatacctggaacaacggtggagatttta
gatggagactccaaaaatattattcaactgattattaatgcatacaatagtatccggtct
aaagtggagttgtcagtctgggatcagcctgaggatcttaatctcttctttactgctacc
tgccaagatggggtatcctatcctggtcagaggaagtgtgagggtctgaagattggggac
acggcatcttttgaagtatcattggaggcccgaagctgtcccagcagacacacggagcat
gtgtttgccctgcggccggtgggattccgggacagcctggaggtgggggtcacctacaac
tgcacgtgcggctgcagcgtggggctggaacccaacagtgccaggtgcaacgggagcggg
acctatgtctgcggcctgtgtgagtgcagccccggctacctgggcaccaggtgcgagtgc
caggatggggagaaccagagcgtgtaccagaacctgtgccgggaggcagagggcaagcca
ctgtgcagcgggcgtggggactgcagctgcaaccagtgctcctgcttcgagagcgagttc
ggcaagatctatgggcctttctgtgagtgcgacaacttctcctgtgccaggaacaaggga
gtcctctgctcaggccatggcgagtgtcactgcggggaatgcaagtgccatgcaggttac
atcggggacaactgtaactgctcgacagacatcagcacatgccggggcagagatggccag
atctgcagcgagcgtgggcactgtctctgtgggcagtgccaatgcacggagccgggggcc
tttggggagatgtgtgagaagtgccccacctgcccggatgcatgcagcaccaagagagat
tgcgtcgagtgcctgctgctccactctgggaaacctgacaaccagacctgccacagccta
tgcagggatgaggtgatcacatgggtggacaccatcgtgaaagatgaccaggaggctgtg
ctatgtttctacaaaaccgccaaggactgcgtcatgatgttcacctatgtggagctcccc
agtgggaagtccaacctgaccgtcctcagggagccagagtgtggaaacacccccaacgcc
atgaccatcctcctggctgtggtcggtagcatcctccttgttgggcttgcactcctggct
atctggaagctgcttgtcaccatccacgaccggagggagtttgcaaagtttcagagcgag
cgatccagggcccgctatgaaatggcttcaaatccattatacagaaagcctatctccacg
cacactgtggacttcaccttcaacaagttcaacaaatcctacaatggcactgtggactga

DBGET integrated database retrieval system