KEGG   Homo sapiens (human): 3693Help
Entry
3693              CDS       T01001                                 

Gene name
ITGB5
Definition
integrin, beta 5
Orthology
K06588  
integrin beta 5
Organism
hsa  Homo sapiens (human)
Pathway
Phagosome
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Regulation of actin cytoskeleton
Proteoglycans in cancer
Hypertrophic cardiomyopathy (HCM)
Arrhythmogenic right ventricular cardiomyopathy (ARVC)
Dilated cardiomyopathy
Drug target
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    3693 (ITGB5)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    3693 (ITGB5)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    3693 (ITGB5)
  Cell motility
   04810 Regulation of actin cytoskeleton
    3693 (ITGB5)
  Cell communication
   04510 Focal adhesion
    3693 (ITGB5)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    3693 (ITGB5)
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    3693 (ITGB5)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    3693 (ITGB5)
   05414 Dilated cardiomyopathy (DCM)
    3693 (ITGB5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
3q21.2
AA seq 799 aa AA seqDB search
MPRAPAPLYACLLGLCALLPRLAGLNICTSGSATSCEECLLIHPKCAWCSKEDFGSPRSI
TSRCDLRANLVKNGCGGEIESPASSFHVLRSLPLSSKGSGSAGWDVIQMTPQEIAVNLRP
GDKTTFQLQVRQVEDYPVDLYYLMDLSLSMKDDLDNIRSLGTKLAEEMRKLTSNFRLGFG
SFVDKDISPFSYTAPRYQTNPCIGYKLFPNCVPSFGFRHLLPLTDRVDSFNEEVRKQRVS
RNRDAPEGGFDAVLQAAVCKEKIGWRKDALHLLVFTTDDVPHIALDGKLGGLVQPHDGQC
HLNEANEYTASNQMDYPSLALLGEKLAENNINLIFAVTKNHYMLYKNFTALIPGTTVEIL
DGDSKNIIQLIINAYNSIRSKVELSVWDQPEDLNLFFTATCQDGVSYPGQRKCEGLKIGD
TASFEVSLEARSCPSRHTEHVFALRPVGFRDSLEVGVTYNCTCGCSVGLEPNSARCNGSG
TYVCGLCECSPGYLGTRCECQDGENQSVYQNLCREAEGKPLCSGRGDCSCNQCSCFESEF
GKIYGPFCECDNFSCARNKGVLCSGHGECHCGECKCHAGYIGDNCNCSTDISTCRGRDGQ
ICSERGHCLCGQCQCTEPGAFGEMCEKCPTCPDACSTKRDCVECLLLHSGKPDNQTCHSL
CRDEVITWVDTIVKDDQEAVLCFYKTAKDCVMMFTYVELPSGKSNLTVLREPECGNTPNA
MTILLAVVGSILLVGLALLAIWKLLVTIHDRREFAKFQSERSRARYEMASNPLYRKPIST
HTVDFTFNKFNKSYNGTVD
NT seq 2400 nt NT seq  +upstreamnt  +downstreamnt
atgccgcgggccccggcgccgctgtacgcctgcctcctggggctctgcgcgctcctgccc
cggctcgcaggtctcaacatatgcactagtggaagtgccacctcatgtgaagaatgtctg
ctaatccacccaaaatgtgcctggtgctccaaagaggacttcggaagcccacggtccatc
acctctcggtgtgatctgagggcaaaccttgtcaaaaatggctgtggaggtgagatagag
agcccagccagcagcttccatgtcctgaggagcctgcccctcagcagcaagggttcgggc
tctgcaggctgggacgtcattcagatgacaccacaggagattgccgtgaacctccggccc
ggtgacaagaccaccttccagctacaggttcgccaggtggaggactatcctgtggacctg
tactacctgatggacctctccctgtccatgaaggatgacttggacaatatccggagcctg
ggcaccaaactcgcggaggagatgaggaagctcaccagcaacttccggttgggatttggg
tcttttgttgataaggacatctctcctttctcctacacggcaccgaggtaccagaccaat
ccgtgcattggttacaagttgtttccaaattgcgtcccctcctttgggttccgccatctg
ctgcctctcacagacagagtggacagcttcaatgaggaagttcggaaacagagggtgtcc
cggaaccgagatgcccctgaggggggctttgatgcagtactccaggcagccgtctgcaag
gagaagattggctggcgaaaggatgcactgcatttgctggtgttcacaacagatgatgtg
ccccacatcgcattggatggaaaattgggaggcctggtgcagccacacgatggccagtgc
cacctgaacgaggccaacgagtacactgcatccaaccagatggactatccatcccttgcc
ttgcttggagagaaattggcagagaacaacatcaacctcatctttgcagtgacaaaaaac
cattatatgctgtacaagaattttacagccctgatacctggaacaacggtggagatttta
gatggagactccaaaaatattattcaactgattattaatgcatacaatagtatccggtct
aaagtggagttgtcagtctgggatcagcctgaggatcttaatctcttctttactgctacc
tgccaagatggggtatcctatcctggtcagaggaagtgtgagggtctgaagattggggac
acggcatcttttgaagtatcattggaggcccgaagctgtcccagcagacacacggagcat
gtgtttgccctgcggccggtgggattccgggacagcctggaggtgggggtcacctacaac
tgcacgtgcggctgcagcgtggggctggaacccaacagtgccaggtgcaacgggagcggg
acctatgtctgcggcctgtgtgagtgcagccccggctacctgggcaccaggtgcgagtgc
caggatggggagaaccagagcgtgtaccagaacctgtgccgggaggcagagggcaagcca
ctgtgcagcgggcgtggggactgcagctgcaaccagtgctcctgcttcgagagcgagttc
ggcaagatctatgggcctttctgtgagtgcgacaacttctcctgtgccaggaacaaggga
gtcctctgctcaggccatggcgagtgtcactgcggggaatgcaagtgccatgcaggttac
atcggggacaactgtaactgctcgacagacatcagcacatgccggggcagagatggccag
atctgcagcgagcgtgggcactgtctctgtgggcagtgccaatgcacggagccgggggcc
tttggggagatgtgtgagaagtgccccacctgcccggatgcatgcagcaccaagagagat
tgcgtcgagtgcctgctgctccactctgggaaacctgacaaccagacctgccacagccta
tgcagggatgaggtgatcacatgggtggacaccatcgtgaaagatgaccaggaggctgtg
ctatgtttctacaaaaccgccaaggactgcgtcatgatgttcacctatgtggagctcccc
agtgggaagtccaacctgaccgtcctcagggagccagagtgtggaaacacccccaacgcc
atgaccatcctcctggctgtggtcggtagcatcctccttgttgggcttgcactcctggct
atctggaagctgcttgtcaccatccacgaccggagggagtttgcaaagtttcagagcgag
cgatccagggcccgctatgaaatggcttcaaatccattatacagaaagcctatctccacg
cacactgtggacttcaccttcaacaagttcaacaaatcctacaatggcactgtggactga

DBGET integrated database retrieval system