KEGG   Homo sapiens (human): 3695Help
Entry
3695              CDS       T01001                                 

Gene name
ITGB7
Definition
integrin, beta 7
Orthology
K06590  
integrin beta 7
Organism
hsa  Homo sapiens (human)
Pathway
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Cell adhesion molecules (CAMs)
Intestinal immune network for IgA production
Regulation of actin cytoskeleton
Transcriptional misregulation in cancer
Hypertrophic cardiomyopathy (HCM)
Arrhythmogenic right ventricular cardiomyopathy (ARVC)
Dilated cardiomyopathy
Drug target
Class
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:hsa04151]
Environmental Information Processing; Signaling molecules and interaction; ECM-receptor interaction [PATH:hsa04512]
Environmental Information Processing; Signaling molecules and interaction; Cell adhesion molecules (CAMs) [PATH:hsa04514]
Cellular Processes; Cell motility; Regulation of actin cytoskeleton [PATH:hsa04810]
Cellular Processes; Cell communication; Focal adhesion [PATH:hsa04510]
Organismal Systems; Immune system; Intestinal immune network for IgA production [PATH:hsa04672]
Human Diseases; Cancers; Transcriptional misregulation in cancers [PATH:hsa05202]
Human Diseases; Cardiovascular diseases; Hypertrophic cardiomyopathy (HCM) [PATH:hsa05410]
Human Diseases; Cardiovascular diseases; Arrhythmogenic right ventricular cardiomyopathy (ARVC) [PATH:hsa05412]
Human Diseases; Cardiovascular diseases; Dilated cardiomyopathy (DCM) [PATH:hsa05414]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
12q13.13
AA seq 798 aa AA seqDB search
MVALPMVLVLLLVLSRGESELDAKIPSTGDATEWRNPHLSMLGSCQPAPSCQKCILSHPS
CAWCKQLNFTASGEAEARRCARREELLARGCPLEELEEPRGQQEVLQDQPLSQGARGEGA
TQLAPQRVRVTLRPGEPQQLQVRFLRAEGYPVDLYYLMDLSYSMKDDLERVRQLGHALLV
RLQEVTHSVRIGFGSFVDKTVLPFVSTVPSKLRHPCPTRLERCQSPFSFHHVLSLTGDAQ
AFEREVGRQSVSGNLDSPEGGFDAILQAALCQEQIGWRNVSRLLVFTSDDTFHTAGDGKL
GGIFMPSDGHCHLDSNGLYSRSTEFDYPSVGQVAQALSAANIQPIFAVTSAALPVYQELS
KLIPKSAVGELSEDSSNVVQLIMDAYNSLSSTVTLEHSSLPPGVHISYESQCEGPEKREG
KAEDRGQCNHVRINQTVTFWVSLQATHCLPEPHLLRLRALGFSEELIVELHTLCDCNCSD
TQPQAPHCSDGQGHLQCGVCSCAPGRLGRLCECSVAELSSPDLESGCRAPNGTGPLCSGK
GHCQCGRCSCSGQSSGHLCECDDASCERHEGILCGGFGRCQCGVCHCHANRTGRACECSG
DMDSCISPEGGLCSGHGRCKCNRCQCLDGYYGALCDQCPGCKTPCERHRDCAECGAFRTG
PLATNCSTACAHTNVTLALAPILDDGWCKERTLDNQLFFFLVEDDARGTVVLRVRPQEKG
ADHTQAIVLGCVGGIVAVGLGLVLAYRLSVEIYDRREYSRFEKEQQQLNWKQDSNPLYKS
AITTTINPRFQEADSPTL
NT seq 2397 nt NT seq  +upstreamnt  +downstreamnt
atggtggctttgccaatggtccttgttttgctgctggtcctgagcagaggtgagagtgaa
ttggacgccaagatcccatccacaggggatgccacagaatggcggaatcctcacctgtcc
atgctggggtcctgccagccagccccctcctgccagaagtgcatcctctcacaccccagc
tgtgcatggtgcaagcaactgaacttcaccgcgtcgggagaggcggaggcgcggcgctgc
gcccgacgagaggagctgctggctcgaggctgcccgctggaggagctggaggagccccgc
ggccagcaggaggtgctgcaggaccagccgctcagccagggcgcccgcggagagggtgcc
acccagctggcgccgcagcgggtccgggtcacgctgcggcctggggagccccagcagctc
caggtccgcttccttcgtgctgagggatacccggtggacctgtactaccttatggacctg
agctactccatgaaggacgacctggaacgcgtgcgccagctcgggcacgctctgctggtc
cggctgcaggaagtcacccattctgtgcgcattggttttggttcctttgtggacaaaacg
gtgctgccctttgtgagcacagtaccctccaaactgcgccacccctgccccacccggctg
gagcgctgccagtcaccattcagctttcaccatgtgctgtccctgacgggggacgcacaa
gccttcgagcgggaggtggggcgccagagtgtgtccggcaatctggactcgcctgaaggt
ggcttcgatgccattctgcaggctgcactctgccaggagcagattggctggagaaatgtg
tcccggctgctggtgttcacttcagacgacacattccatacagctggggacgggaagttg
ggcggcattttcatgcccagtgatgggcactgccacttggacagcaatggcctctacagt
cgcagcacagagtttgactacccttctgtgggtcaggtagcccaggccctctctgcagca
aatatccagcccatctttgctgtcaccagtgccgcactgcctgtctaccaggagctgagt
aaactgattcctaagtctgcagttggggagctgagtgaggactccagcaacgtggtacag
ctcatcatggatgcttataatagcctgtcttccaccgtgacccttgaacactcttcactc
cctcctggggtccacatttcttacgaatcccagtgtgagggtcctgagaagagggagggt
aaggctgaggatcgaggacagtgcaaccacgtccgaatcaaccagacggtgactttctgg
gtttctctccaagccacccactgcctcccagagccccatctcctgaggctccgggccctt
ggcttctcagaggagctgattgtggagttgcacacgctgtgtgactgtaattgcagtgac
acccagccccaggctccccactgcagtgatggccagggacacctacaatgtggtgtatgc
agctgtgcccctggccgcctaggtcggctctgtgagtgctctgtggcagagctgtcctcc
ccagacctggaatctgggtgccgggctcccaatggcacagggcccctgtgcagtggaaag
ggtcactgtcaatgtggacgctgcagctgcagtggacagagctctgggcatctgtgcgag
tgtgacgatgccagctgtgagcgacatgagggcatcctctgcggaggctttggtcgctgc
caatgtggagtatgtcactgtcatgccaaccgcacgggcagagcatgcgaatgcagtggg
gacatggacagttgcatcagtcccgagggagggctctgcagtgggcatggacgctgcaaa
tgcaaccgctgccagtgcttggacggctactatggtgctctatgcgaccaatgcccaggc
tgcaagacaccatgcgagagacaccgggactgtgcagagtgtggggccttcaggactggc
ccactggccaccaactgcagtacagcttgtgcccataccaatgtgaccctggccttggcc
cctatcttggatgatggctggtgcaaagagcggaccctggacaaccagctgttcttcttc
ttggtggaggatgacgccagaggcacggtcgtgctcagagtgagaccccaagaaaaggga
gcagaccacacgcaggccattgtgctgggctgcgtagggggcatcgtggcagtggggctg
gggctggtcctggcttaccggctctcggtggaaatctatgaccgccgggaatacagtcgc
tttgagaaggagcagcaacaactcaactggaagcaggacagtaatcctctctacaaaagt
gccatcacgaccaccatcaatcctcgctttcaagaggcagacagtcccactctctga

DBGET integrated database retrieval system