KEGG   Homo sapiens (human): 3695Help
Entry
3695              CDS       T01001                                 

Gene name
ITGB7
Definition
integrin, beta 7
Orthology
K06590  
integrin beta 7
Organism
hsa  Homo sapiens (human)
Pathway
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Cell adhesion molecules (CAMs)
Intestinal immune network for IgA production
Regulation of actin cytoskeleton
Transcriptional misregulation in cancer
Hypertrophic cardiomyopathy (HCM)
Arrhythmogenic right ventricular cardiomyopathy (ARVC)
Dilated cardiomyopathy
Drug target
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    3695 (ITGB7)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    3695 (ITGB7)
   04514 Cell adhesion molecules (CAMs)
    3695 (ITGB7)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    3695 (ITGB7)
  Cell communication
   04510 Focal adhesion
    3695 (ITGB7)
 Organismal Systems
  Immune system
   04672 Intestinal immune network for IgA production
    3695 (ITGB7)
 Human Diseases
  Cancers
   05202 Transcriptional misregulation in cancers
    3695 (ITGB7)
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    3695 (ITGB7)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    3695 (ITGB7)
   05414 Dilated cardiomyopathy (DCM)
    3695 (ITGB7)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   3695 (ITGB7)
Cell adhesion molecules and their ligands [BR:hsa04516]
 5. Cadherin Family
  Classic Cadherins
   Vertebrate Type I classic cadherins
    CDHE, CDH1; cadherin 1, type 1, E-cadherin [KO:K05689]
     alpha E beta 7 Cell adhesion molecules (CAMs)
      3695 (ITGB7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
12q13.13
AA seq 798 aa AA seqDB search
MVALPMVLVLLLVLSRGESELDAKIPSTGDATEWRNPHLSMLGSCQPAPSCQKCILSHPS
CAWCKQLNFTASGEAEARRCARREELLARGCPLEELEEPRGQQEVLQDQPLSQGARGEGA
TQLAPQRVRVTLRPGEPQQLQVRFLRAEGYPVDLYYLMDLSYSMKDDLERVRQLGHALLV
RLQEVTHSVRIGFGSFVDKTVLPFVSTVPSKLRHPCPTRLERCQSPFSFHHVLSLTGDAQ
AFEREVGRQSVSGNLDSPEGGFDAILQAALCQEQIGWRNVSRLLVFTSDDTFHTAGDGKL
GGIFMPSDGHCHLDSNGLYSRSTEFDYPSVGQVAQALSAANIQPIFAVTSAALPVYQELS
KLIPKSAVGELSEDSSNVVQLIMDAYNSLSSTVTLEHSSLPPGVHISYESQCEGPEKREG
KAEDRGQCNHVRINQTVTFWVSLQATHCLPEPHLLRLRALGFSEELIVELHTLCDCNCSD
TQPQAPHCSDGQGHLQCGVCSCAPGRLGRLCECSVAELSSPDLESGCRAPNGTGPLCSGK
GHCQCGRCSCSGQSSGHLCECDDASCERHEGILCGGFGRCQCGVCHCHANRTGRACECSG
DMDSCISPEGGLCSGHGRCKCNRCQCLDGYYGALCDQCPGCKTPCERHRDCAECGAFRTG
PLATNCSTACAHTNVTLALAPILDDGWCKERTLDNQLFFFLVEDDARGTVVLRVRPQEKG
ADHTQAIVLGCVGGIVAVGLGLVLAYRLSVEIYDRREYSRFEKEQQQLNWKQDSNPLYKS
AITTTINPRFQEADSPTL
NT seq 2397 nt NT seq  +upstreamnt  +downstreamnt
atggtggctttgccaatggtccttgttttgctgctggtcctgagcagaggtgagagtgaa
ttggacgccaagatcccatccacaggggatgccacagaatggcggaatcctcacctgtcc
atgctggggtcctgccagccagccccctcctgccagaagtgcatcctctcacaccccagc
tgtgcatggtgcaagcaactgaacttcaccgcgtcgggagaggcggaggcgcggcgctgc
gcccgacgagaggagctgctggctcgaggctgcccgctggaggagctggaggagccccgc
ggccagcaggaggtgctgcaggaccagccgctcagccagggcgcccgcggagagggtgcc
acccagctggcgccgcagcgggtccgggtcacgctgcggcctggggagccccagcagctc
caggtccgcttccttcgtgctgagggatacccggtggacctgtactaccttatggacctg
agctactccatgaaggacgacctggaacgcgtgcgccagctcgggcacgctctgctggtc
cggctgcaggaagtcacccattctgtgcgcattggttttggttcctttgtggacaaaacg
gtgctgccctttgtgagcacagtaccctccaaactgcgccacccctgccccacccggctg
gagcgctgccagtcaccattcagctttcaccatgtgctgtccctgacgggggacgcacaa
gccttcgagcgggaggtggggcgccagagtgtgtccggcaatctggactcgcctgaaggt
ggcttcgatgccattctgcaggctgcactctgccaggagcagattggctggagaaatgtg
tcccggctgctggtgttcacttcagacgacacattccatacagctggggacgggaagttg
ggcggcattttcatgcccagtgatgggcactgccacttggacagcaatggcctctacagt
cgcagcacagagtttgactacccttctgtgggtcaggtagcccaggccctctctgcagca
aatatccagcccatctttgctgtcaccagtgccgcactgcctgtctaccaggagctgagt
aaactgattcctaagtctgcagttggggagctgagtgaggactccagcaacgtggtacag
ctcatcatggatgcttataatagcctgtcttccaccgtgacccttgaacactcttcactc
cctcctggggtccacatttcttacgaatcccagtgtgagggtcctgagaagagggagggt
aaggctgaggatcgaggacagtgcaaccacgtccgaatcaaccagacggtgactttctgg
gtttctctccaagccacccactgcctcccagagccccatctcctgaggctccgggccctt
ggcttctcagaggagctgattgtggagttgcacacgctgtgtgactgtaattgcagtgac
acccagccccaggctccccactgcagtgatggccagggacacctacaatgtggtgtatgc
agctgtgcccctggccgcctaggtcggctctgtgagtgctctgtggcagagctgtcctcc
ccagacctggaatctgggtgccgggctcccaatggcacagggcccctgtgcagtggaaag
ggtcactgtcaatgtggacgctgcagctgcagtggacagagctctgggcatctgtgcgag
tgtgacgatgccagctgtgagcgacatgagggcatcctctgcggaggctttggtcgctgc
caatgtggagtatgtcactgtcatgccaaccgcacgggcagagcatgcgaatgcagtggg
gacatggacagttgcatcagtcccgagggagggctctgcagtgggcatggacgctgcaaa
tgcaaccgctgccagtgcttggacggctactatggtgctctatgcgaccaatgcccaggc
tgcaagacaccatgcgagagacaccgggactgtgcagagtgtggggccttcaggactggc
ccactggccaccaactgcagtacagcttgtgcccataccaatgtgaccctggccttggcc
cctatcttggatgatggctggtgcaaagagcggaccctggacaaccagctgttcttcttc
ttggtggaggatgacgccagaggcacggtcgtgctcagagtgagaccccaagaaaaggga
gcagaccacacgcaggccattgtgctgggctgcgtagggggcatcgtggcagtggggctg
gggctggtcctggcttaccggctctcggtggaaatctatgaccgccgggaatacagtcgc
tttgagaaggagcagcaacaactcaactggaagcaggacagtaatcctctctacaaaagt
gccatcacgaccaccatcaatcctcgctttcaagaggcagacagtcccactctctga

DBGET integrated database retrieval system