KEGG   Homo sapiens (human): 3704Help
Entry
3704              CDS       T01001                                 

Gene name
ITPA, C20orf37, HLC14-06-P, dJ794I6.3
Definition
inosine triphosphatase (nucleoside triphosphate pyrophosphatase) (EC:3.6.1.19)
Orthology
K01519  
inosine triphosphate pyrophosphatase [EC:3.6.1.19]
Organism
hsa  Homo sapiens (human)
Pathway
Purine metabolism
Pyrimidine metabolism
Drug metabolism - other enzymes
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:hsa00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:hsa00240]
Metabolism; Xenobiotics biodegradation and metabolism; Drug metabolism - other enzymes [PATH:hsa00983]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
20p
AA seq 153 aa AA seqDB search
MAASLVGKKIVFVTGNAKKLEEVQGPVLVEDTCLCFNALGGLPGPYIKWFLEKLKPEGLH
QLLAGFEDKSAYALCTFALSTGDPSQPVRLFRGRTSGRIVAPRGCQDFGWDPCFQPDGYE
QTYAEMPKAEKNAVSHRFRALLELQEYFGSLAA
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
atggcggcctcattggtggggaagaagatcgtgtttgtaacggggaacgccaagaagctg
gaggaggtacaggggcccgtgctggttgaggacacttgtctgtgcttcaatgcccttgga
gggctccccggcccctacataaagtggtttctggagaagttaaagcctgaaggtctccac
cagctcctggccgggttcgaggacaagtcagcctatgcgctctgcacgtttgcactcagc
accggggacccaagccagcccgtgcgcctgttcaggggccggacctcgggccggatcgtg
gcacccagaggctgccaggactttggctgggacccctgctttcagcctgatggatatgag
cagacgtacgcagagatgcctaaggcggagaagaacgctgtctcccatcgcttccgggcc
ctgctggagctgcaggagtactttggcagtttggcagcttga

DBGET integrated database retrieval system