KEGG   Homo sapiens (human): 3708Help
Entry
3708              CDS       T01001                                 

Gene name
ITPR1, ACV, CLA4, INSP3R1, IP3R, IP3R1, SCA15, SCA16, SCA29
Definition
inositol 1,4,5-trisphosphate receptor, type 1
Orthology
K04958  
inositol 1,4,5-triphosphate receptor type 1
Organism
hsa  Homo sapiens (human)
Pathway
Calcium signaling pathway
cGMP-PKG signaling pathway
Phosphatidylinositol signaling system
Oocyte meiosis
Vascular smooth muscle contraction
Gap junction
Platelet activation
Circadian entrainment
Long-term potentiation
Retrograde endocannabinoid signaling
Glutamatergic synapse
Cholinergic synapse
Serotonergic synapse
Dopaminergic synapse
Long-term depression
Inflammatory mediator regulation of TRP channels
GnRH signaling pathway
Estrogen signaling pathway
Thyroid hormone synthesis
Oxytocin signaling pathway
Salivary secretion
Gastric acid secretion
Pancreatic secretion
Alzheimer's disease
Huntington's disease
Proteoglycans in cancer
Disease
H00063  
Spinocerebellar ataxia (SCA)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    3708 (ITPR1)
   04070 Phosphatidylinositol signaling system
    3708 (ITPR1)
   04022 cGMP - PKG signaling pathway
    3708 (ITPR1)
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    3708 (ITPR1)
  Cellular commiunity
   04540 Gap junction
    3708 (ITPR1)
 Organismal Systems
  Immune system
   04611 Platelet activation
    3708 (ITPR1)
  Endocrine system
   04912 GnRH signaling pathway
    3708 (ITPR1)
   04915 Estrogen signaling pathway
    3708 (ITPR1)
   04921 Oxytocin signaling pathway
    3708 (ITPR1)
   04918 Thyroid hormone synthesis
    3708 (ITPR1)
  Circulatory system
   04270 Vascular smooth muscle contraction
    3708 (ITPR1)
  Digestive system
   04970 Salivary secretion
    3708 (ITPR1)
   04971 Gastric acid secretion
    3708 (ITPR1)
   04972 Pancreatic secretion
    3708 (ITPR1)
  Nervous system
   04724 Glutamatergic synapse
    3708 (ITPR1)
   04725 Cholinergic synapse
    3708 (ITPR1)
   04728 Dopaminergic synapse
    3708 (ITPR1)
   04726 Serotonergic synapse
    3708 (ITPR1)
   04720 Long-term potentiation
    3708 (ITPR1)
   04730 Long-term depression
    3708 (ITPR1)
   04723 Retrograde endocannabinoid signaling
    3708 (ITPR1)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    3708 (ITPR1)
  Environmental adaptation
   04713 Circadian entrainment
    3708 (ITPR1)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    3708 (ITPR1)
  Neurodegenerative diseases
   05010 Alzheimer's disease
    3708 (ITPR1)
   05016 Huntington's disease
    3708 (ITPR1)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     3708 (ITPR1)
Ion channels [BR:hsa04040]
 Ryanodine and IP3 receptors
  IP3 receptor
   3708 (ITPR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
3p26.1
AA seq 2710 aa AA seqDB search
MSDKMSSFLHIGDICSLYAEGSTNGFISTLGLVDDRCVVQPETGDLNNPPKKFRDCLFKL
CPMNRYSAQKQFWKAAKPGANSTTDAVLLNKLHHAADLEKKQNETENRKLLGTVIQYGNV
IQLLHLKSNKYLTVNKRLPALLEKNAMRVTLDEAGNEGSWFYIQPFYKLRSIGDSVVIGD
KVVLNPVNAGQPLHASSHQLVDNPGCNEVNSVNCNTSWKIVLFMKWSDNKDDILKGGDVV
RLFHAEQEKFLTCDEHRKKQHVFLRTTGRQSATSATSSKALWEVEVVQHDPCRGGAGYWN
SLFRFKHLATGHYLAAEVDPDFEEECLEFQPSVDPDQDASRSRLRNAQEKMVYSLVSVPE
GNDISSIFELDPTTLRGGDSLVPRNSYVRLRHLCTNTWVHSTNIPIDKEEEKPVMLKIGT
SPVKEDKEAFAIVPVSPAEVRDLDFANDASKVLGSIAGKLEKGTITQNERRSVTKLLEDL
VYFVTGGTNSGQDVLEVVFSKPNRERQKLMREQNILKQIFKLLQAPFTDCGDGPMLRLEE
LGDQRHAPFRHICRLCYRVLRHSQQDYRKNQEYIAKQFGFMQKQIGYDVLAEDTITALLH
NNRKLLEKHITAAEIDTFVSLVRKNREPRFLDYLSDLCVSMNKSIPVTQELICKAVLNPT
NADILIETKLVLSRFEFEGVSSTGENALEAGEDEEEVWLFWRDSNKEIRSKSVRELAQDA
KEGQKEDRDVLSYYRYQLNLFARMCLDRQYLAINEISGQLDVDLILRCMSDENLPYDLRA
SFCRLMLHMHVDRDPQEQVTPVKYARLWSEIPSEIAIDDYDSSGASKDEIKERFAQTMEF
VEEYLRDVVCQRFPFSDKEKNKLTFEVVNLARNLIYFGFYNFSDLLRLTKILLAILDCVH
VTTIFPISKMAKGEENKGSNVMRSIHGVGELMTQVVLRGGGFLPMTPMAAAPEGNVKQAE
PEKEDIMVMDTKLKIIEILQFILNVRLDYRISCLLCIFKREFDESNSQTSETSSGNSSQE
GPSNVPGALDFEHIEEQAEGIFGGSEENTPLDLDDHGGRTFLRVLLHLTMHDYPPLVSGA
LQLLFRHFSQRQEVLQAFKQVQLLVTSQDVDNYKQIKQDLDQLRSIVEKSELWVYKGQGP
DETMDGASGENEHKKTEEGNNKPQKHESTSSYNYRVVKEILIRLSKLCVQESASVRKSRK
QQQRLLRNMGAHAVVLELLQIPYEKAEDTKMQEIMRLAHEFLQNFCAGNQQNQALLHKHI
NLFLNPGILEAVTMQHIFMNNFQLCSEINERVVQHFVHCIETHGRNVQYIKFLQTIVKAE
GKFIKKCQDMVMAELVNSGEDVLVFYNDRASFQTLIQMMRSERDRMDENSPLMYHIHLVE
LLAVCTEGKNVYTEIKCNSLLPLDDIVRVVTHEDCIPEVKIAYINFLNHCYVDTEVEMKE
IYTSNHMWKLFENFLVDICRACNNTSDRKHADSILEKYVTEIVMSIVTTFFSSPFSDQST
TLQTRQPVFVQLLQGVFRVYHCNWLMPSQKASVESCIRVLSDVAKSRAIAIPVDLDSQVN
NLFLKSHSIVQKTAMNWRLSARNAARRDSVLAASRDYRNIIERLQDIVSALEDRLRPLVQ
AELSVLVDVLHRPELLFPENTDARRKCESGGFICKLIKHTKQLLEENEEKLCIKVLQTLR
EMMTKDRGYGEKGEALRQVLVNRYYGNVRPSGRRESLTSFGNGPLSAGGPGKPGGGGGGS
GSSSMSRGEMSLAEVQCHLDKEGASNLVIDLIMNASSDRVFHESILLAIALLEGGNTTIQ
HSFFCRLTEDKKSEKFFKVFYDRMKVAQQEIKATVTVNTSDLGNKKKDDEVDRDAPSRKK
AKEPTTQITEEVRDQLLEASAATRKAFTTFRREADPDDHYQPGEGTQATADKAKDDLEMS
AVITIMQPILRFLQLLCENHNRDLQNFLRCQNNKTNYNLVCETLQFLDCICGSTTGGLGL
LGLYINEKNVALINQTLESLTEYCQGPCHENQNCIATHESNGIDIITALILNDINPLGKK
RMDLVLELKNNASKLLLAIMESRHDSENAERILYNMRPKELVEVIKKAYMQGEVEFEDGE
NGEDGAASPRNVGHNIYILAHQLARHNKELQSMLKPGGQVDGDEALEFYAKHTAQIEIVR
LDRTMEQIVFPVPSICEFLTKESKLRIYYTTERDEQGSKINDFFLRSEDLFNEMNWQKKL
RAQPVLYWCARNMSFWSSISFNLAVLMNLLVAFFYPFKGVRGGTLEPHWSGLLWTAMLIS
LAIVIALPKPHGIRALIASTILRLIFSVGLQPTLFLLGAFNVCNKIIFLMSFVGNCGTFT
RGYRAMVLDVEFLYHLLYLVICAMGLFVHEFFYSLLLFDLVYREETLLNVIKSVTRNGRS
IILTAVLALILVYLFSIVGYLFFKDDFILEVDRLPNETAVPETGESLASEFLFSDVCRVE
SGENCSSPAPREELVPAEETEQDKEHTCETLLMCIVTVLSHGLRSGGGVGDVLRKPSKEE
PLFAARVIYDLLFFFMVIIIVLNLIFGVIIDTFADLRSEKQKKEEILKTTCFICGLERDK
FDNKTVTFEEHIKEEHNMWHYLCFIVLVKVKDSTEYTGPESYVAEMIKERNLDWFPRMRA
MSLVSSDSEGEQNELRNLQEKLESTMKLVTNLSGQLSELKDQMTEQRKQKQRIGLLGHPP
HMNVNPQQPA
NT seq 8133 nt NT seq  +upstreamnt  +downstreamnt
atgtctgacaaaatgtctagcttcctacatattggagacatttgttctctgtacgcggag
ggatcgacaaatggatttattagcaccttgggcctggttgatgatcgttgtgttgtacag
ccagaaaccggggaccttaacaatccacctaagaaattcagagactgcctctttaagcta
tgtcccatgaaccgctactctgcccaaaagcagttctggaaagccgctaagcctggggcc
aacagcaccacagacgcagtgctactcaacaaactgcaccacgctgcagacttggaaaag
aagcagaatgagacagaaaacaggaaattgctggggaccgtaatccagtatggcaatgtg
atccagctcctgcatttgaaaagtaataaatacctaacagtgaataagaggcttcctgct
ctgttggagaagaatgccatgagagtcacattggacgaggctggaaatgaagggtcctgg
ttttatattcagccattctacaagctgcgatccattggagacagcgtggtcataggtgac
aaggtggttctgaaccccgtcaatgctggtcagcccctacatgctagcagccatcaactg
gtagataacccaggctgcaatgaggtcaattccgtcaactgcaatacaagctggaaaata
gtccttttcatgaaatggagtgataacaaagacgacatattaaaggggggtgacgtggtg
aggctgtttcatgctgagcaggagaagtttctcacctgtgacgaacacaggaagaagcag
cacgtcttcctgagaaccacgggccggcagtcggccacatctgccaccagttcaaaagcc
ctgtgggaggtggaggtggtccagcatgacccatgtcggggcggagcagggtattggaac
agccttttccgtttcaagcatctggccacggggcattacttggcagcagaggtagaccct
gactttgaggaagaatgcctggagtttcagccctcagtggaccctgatcaggacgcctct
cgaagtaggttgcggaatgcccaagaaaagatggtatactccctggtctctgtgcctgaa
ggcaatgacatctcctccattttcgagctagatcccaccactctgcgtggaggtgacagc
cttgtcccaaggaactcttatgttcggctcagacacctatgtactaatacctgggttcac
agcacaaatattcctattgacaaggaagaagaaaagcccgtgatgctgaaaattggcacc
tctcctgtgaaggaggataaggaagcatttgccatagttccggtttctcctgctgaagtt
cgggacctggactttgccaatgatgccagcaaggtgctgggctccattgctgggaagcta
gagaagggcaccatcacccagaatgaaaggaggtctgtaaccaagctgctagaagatttg
gtttacttcgtcactggtggaactaattctggtcaagatgttctcgaagttgtcttctcc
aagcccaacagagaacggcagaaactgatgagagaacagaatattctcaagcagatcttc
aagttgttacaagccccattcacagactgcggtgatggcccaatgcttcggctggaagag
ctcggggaccagcggcacgctcctttcagacacatctgccggctctgctacagggtgctg
agacactcgcagcaagactacaggaagaaccaggagtatatagccaagcagtttggcttc
atgcagaagcagattggctatgatgtgttggctgaagacactatcactgccctgctccac
aataatcggaaactcctggaaaaacacattaccgcggcagagattgacacatttgtcagc
ctggtgcgaaagaacagggagcccagattcttagattacctctccgacctctgtgtctcc
atgaacaaatcaattccagtgacccaggaactgatatgtaaagctgtgctgaaccccacc
aacgctgacatcctgattgagaccaagttggttctttctcgttttgaatttgaaggtgtc
tcttccactggagagaatgctctggaggcaggagaagacgaggaagaggtgtggctgttt
tggagggacagcaacaaagagattcgcagcaagagtgtgagggaattggctcaggatgct
aaagaagggcagaaggaggaccgagacgttctcagctactacagatatcagctgaacctc
tttgcgaggatgtgtctggaccgccaatacctggccatcaacgaaatctcaggccagctg
gatgtcgatctcattctccgctgcatgtctgacgagaacctgccctatgacctcagggcg
tccttctgccgcctcatgcttcacatgcatgtggaccgagatccccaggaacaagtcacc
cccgtgaaatatgcccgcctctggtcggagattccctcggagatcgccattgacgactat
gatagtagtggagcttccaaagatgaaattaaggagagatttgctcagaccatggagttt
gtggaggagtatttaagagatgtggtttgtcagaggttccctttctctgataaagagaag
aataagcttacgtttgaggttgtaaatttagctaggaatctcatatactttggtttctac
aacttctctgaccttctacgattaactaagatccttctggccatattggactgtgtacat
gtgacaacaatcttccccattagcaagatggcgaaaggagaagagaataaaggcagtaac
gtgatgagatctattcatggcgtgggagagctgatgacccaggtggtgctccggggagga
ggctttttgcccatgactcccatggctgctgcccctgaaggcaatgtgaagcaggcagag
cctgagaaggaggacatcatggtcatggacaccaagctgaagatcattgagatactccag
tttattttgaatgtgaggttggattataggatctcctgcctcctgtgtatatttaagcga
gagtttgatgaaagcaattcccagacttcagaaacatcctccggaaacagcagccaagaa
gggccaagtaatgtaccaggtgctcttgactttgaacacattgaagaacaagcagaaggc
atctttggaggaagtgaggagaacaccccactggacttggatgaccacggcggcagaacc
tttctccgtgtcctgctccacttgacgatgcatgactacccacccctggtgtcaggggcc
ctgcagctcctcttccggcacttcagccagaggcaggaggtgctccaggccttcaaacag
gttcaactgctggttaccagccaagatgtggacaactacaaacagatcaaacaagacttg
gatcaactgaggtccatcgtggaaaagtcagagctttgggtgtacaaagggcagggcccc
gatgagactatggatggtgcatctggagaaaatgaacataagaaaacggaggagggaaat
aacaagccacaaaagcatgaaagcaccagcagctacaactacagagtggtcaaagagatt
ttgattcggcttagcaaactctgtgttcaagagagtgcctcagtgagaaagagcaggaag
cagcaacagcgtctgctccggaacatgggcgcgcacgccgtggtgctggagctgctgcag
attccctatgagaaggccgaagataccaagatgcaagagataatgaggttggctcatgaa
tttttgcagaatttctgcgcaggcaaccagcagaatcaagctttgctacataaacacata
aacctgtttctcaacccagggatcctggaggcagtaaccatgcagcacatcttcatgaac
aatttccagctttgcagtgagatcaacgagagagttgttcagcacttcgttcactgcata
gagactcacggtcggaatgtccagtatataaagttcttacagacaattgtcaaggcagaa
gggaaatttattaaaaaatgccaagacatggttatggccgagctggtcaattcgggagag
gatgtcctcgtgttctacaacgacagagcctctttccagactctgatccagatgatgcgg
tcagaacgggatcggatggatgagaacagccctctcatgtaccacatccacttggtcgag
ctcctggctgtgtgcacggagggtaagaatgtctacacagagatcaagtgcaactccctg
ctcccgctggatgacatcgttcgcgtggtgacccacgaggactgcatccctgaggttaaa
attgcatacattaacttcctgaatcactgctatgtggatacagaggtggaaatgaaggag
atttataccagcaatcacatgtggaaattgtttgagaatttccttgtagacatctgcagg
gcctgtaacaacactagtgacaggaaacatgcagactcgattttggagaagtatgtcacc
gaaatcgtcatgagtattgttactactttcttcagctctcccttctcagaccagagtacg
actttgcagactcgccagcctgtctttgtgcaactgctgcaaggcgtgttcagggtttac
cactgcaactggttaatgccaagccaaaaagcctccgtggagagctgtattcgggtgctg
tctgatgtagccaagagccgggccattgccattcccgtggacctggacagccaagtcaac
aacctctttctcaagtcccacagcattgtgcagaaaacagccatgaactggcggctctca
gcccgcaatgccgcacgcagggactctgttctggcagcttccagagactaccggaatatc
attgagagattgcaggacatcgtctccgcgctggaggaccgtctcaggcccctggtgcag
gcagagttatctgtgctcgtggatgttctccacagacccgagctgcttttcccagagaac
acagacgccagaaggaaatgtgaaagtggcggtttcatttgcaagttaataaagcataca
aaacagctgctagaagaaaatgaagagaagctctgcattaaggtcctacagaccctgagg
gaaatgatgaccaaagatagaggctatggagaaaagggtgaggcgctcaggcaagttctg
gtcaaccgttactatggaaacgtcagaccttcgggacgaagagagagccttaccagcttt
ggcaatggcccactgtcagcaggaggacccggcaagcccgggggaggagggggaggttcc
ggatccagctctatgagcaggggtgagatgagtctggccgaggttcagtgtcaccttgac
aaggagggggcttccaatctagttatcgacctcatcatgaacgcatccagtgaccgagtg
ttccatgaaagcattctcctggccattgcccttctggaaggaggcaacaccaccatccag
cactcctttttctgtcgcttgacagaagataagaagtcagagaaattctttaaggtgttt
tatgaccggatgaaggtggcccagcaagaaatcaaagcaacagtgacagtgaacaccagt
gacttgggaaataaaaagaaagacgatgaggtagacagggatgccccatcacggaaaaaa
gctaaagagcccacaacacagataacagaagaggtccgggatcagctcctggaggcctcc
gctgccaccaggaaagccttcaccactttcaggagggaggctgatcccgacgaccactac
cagcctggagagggcacccaggccactgccgacaaggccaaggacgacctggagatgagc
gcggtcatcaccatcatgcagcccatcctccgcttccttcagctcctgtgtgaaaaccac
aaccgagacctgcagaacttcctccgttgccaaaataacaagaccaactacaatttggta
tgtgagaccctgcagtttctggactgtatttgtggaagcacaactggaggccttggtctt
ctgggcttgtatataaatgaaaagaacgtagcgcttatcaaccaaaccctggaaagtctg
accgaatactgtcaaggaccttgccatgagaaccagaactgcatagccacccatgaatcc
aatggcattgacatcatcacagccctgatcctcaatgatatcaatcctttgggaaagaag
aggatggaccttgtgttagaactgaagaacaatgcctcgaagttgctcctggccatcatg
gaaagcaggcacgacagtgaaaacgcagagaggatactttataacatgaggcccaaggaa
ctggtggaagtgatcaagaaagcctacatgcaaggtgaagtggaatttgaggatggagaa
aacggtgaggatggggcggcgtcccccaggaacgtggggcacaacatctacatattagcc
catcagttggctcggcataacaaagaacttcagagcatgctgaaacctggtggccaagtg
gacggagatgaagccctggagttttatgccaagcacacggcgcagatagagattgtcaga
ttagaccgaacaatggaacagatagtctttcccgtgcccagcatatgtgaattcctaacc
aaggagtcaaaactacgaatttactatactacagagagagacgaacaaggcagcaaaatc
aatgatttctttctgcggtctgaagacctcttcaatgaaatgaattggcagaagaaactg
agagcccagcccgtgttgtactggtgtgcccgcaacatgtctttctggagcagcatttcg
tttaacctggccgtcctgatgaacctgctggtggcgtttttctacccgtttaagggagtc
cgaggaggaaccctggagccccactggtcgggactcctgtggacagccatgctcatctct
ctggccatcgtcattgccctccccaagccccatggcatccgggccttaattgcctccaca
attctacgactgatattttcagtcgggttacaacccacgttgtttcttctgggcgctttc
aatgtatgcaataaaatcatctttctaatgagctttgtgggcaactgtgggacattcaca
agaggctaccgagccatggttctggatgttgagttcctctatcatttgttgtatctggtg
atctgtgccatggggctctttgtccatgaattcttctacagtctgctgctttttgattta
gtgtacagagaagagactttgcttaatgtcattaaaagtgtcactcgcaatggacggtcc
atcatcctgacagcagttctggctctgatcctcgtttacctgttctcaatagtgggctat
cttttcttcaaggatgactttatcttggaagtagataggctgcccaatgaaacagctgtt
ccagaaaccggcgagagtttggcaagcgagttcctgttctccgatgtgtgtagggtggag
agtggggagaactgctcctctcctgcacccagagaagagctggtccctgcagaagagacg
gaacaggataaagagcacacatgtgagacgctgctgatgtgcattgtcactgtgctgagt
cacgggctgcggagcgggggtggagtaggagatgtactcaggaagccgtccaaagaggaa
cccctgtttgctgctagagttatttatgacctcttgttcttcttcatggtcatcatcatt
gttcttaacctgatttttggggttatcattgacacttttgctgacctgaggagtgagaag
cagaagaaggaagagatcttgaagaccacgtgctttatctgtggcttggaaagagacaag
tttgacaacaagactgtcacctttgaagagcacatcaaggaagaacacaacatgtggcac
tatctgtgcttcatcgtcctggtgaaagtaaaggactccaccgaatatactgggcctgag
agttacgtggcagaaatgatcaaggaaagaaaccttgactggttccccaggatgagagcc
atgtcattggtcagcagtgattctgaaggagaacagaatgagctgagaaacctgcaggag
aagctggagtccaccatgaaacttgtcacgaacctttctggccagctgtcggaattaaag
gatcagatgacagaacaaaggaagcagaaacaaagaattggtcttctaggacatcctcct
cacatgaatgtcaacccacaacaaccagcataa

DBGET integrated database retrieval system