KEGG   Homo sapiens (human): 3709Help
Entry
3709              CDS       T01001                                 

Gene name
ITPR2, CFAP48, IP3R2
Definition
inositol 1,4,5-trisphosphate receptor, type 2
Orthology
K04959  
inositol 1,4,5-triphosphate receptor type 2
Organism
hsa  Homo sapiens (human)
Pathway
Calcium signaling pathway
cGMP-PKG signaling pathway
Phosphatidylinositol signaling system
Oocyte meiosis
Vascular smooth muscle contraction
Gap junction
Platelet activation
Long-term potentiation
Retrograde endocannabinoid signaling
Glutamatergic synapse
Cholinergic synapse
Serotonergic synapse
Dopaminergic synapse
Long-term depression
Inflammatory mediator regulation of TRP channels
GnRH signaling pathway
Estrogen signaling pathway
Thyroid hormone synthesis
Oxytocin signaling pathway
Salivary secretion
Gastric acid secretion
Pancreatic secretion
Alzheimer's disease
Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    3709 (ITPR2)
   04070 Phosphatidylinositol signaling system
    3709 (ITPR2)
   04022 cGMP - PKG signaling pathway
    3709 (ITPR2)
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    3709 (ITPR2)
  Cellular commiunity
   04540 Gap junction
    3709 (ITPR2)
 Organismal Systems
  Immune system
   04611 Platelet activation
    3709 (ITPR2)
  Endocrine system
   04912 GnRH signaling pathway
    3709 (ITPR2)
   04915 Estrogen signaling pathway
    3709 (ITPR2)
   04921 Oxytocin signaling pathway
    3709 (ITPR2)
   04918 Thyroid hormone synthesis
    3709 (ITPR2)
  Circulatory system
   04270 Vascular smooth muscle contraction
    3709 (ITPR2)
  Digestive system
   04970 Salivary secretion
    3709 (ITPR2)
   04971 Gastric acid secretion
    3709 (ITPR2)
   04972 Pancreatic secretion
    3709 (ITPR2)
  Nervous system
   04724 Glutamatergic synapse
    3709 (ITPR2)
   04725 Cholinergic synapse
    3709 (ITPR2)
   04728 Dopaminergic synapse
    3709 (ITPR2)
   04726 Serotonergic synapse
    3709 (ITPR2)
   04720 Long-term potentiation
    3709 (ITPR2)
   04730 Long-term depression
    3709 (ITPR2)
   04723 Retrograde endocannabinoid signaling
    3709 (ITPR2)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    3709 (ITPR2)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    3709 (ITPR2)
  Neurodegenerative diseases
   05010 Alzheimer's disease
    3709 (ITPR2)
Ion channels [BR:hsa04040]
 Ryanodine and IP3 receptors
  IP3 receptor
   3709 (ITPR2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
12p11
AA seq 2701 aa AA seqDB search
MTEKMSSFLYIGDIVSLYAEGSVNGFISTLGLVDDRCVVHPEAGDLANPPKKFRDCLFKV
CPMNRYSAQKQYWKAKQAKQGNHTEAALLKKLQHAAELEQKQNESENKKLLGEIVKYSNV
IQLLHIKSNKYLTVNKRLPALLEKNAMRVSLDAAGNEGSWFYIHPFWKLRSEGDNIVVGD
KVVLMPVNAGQPLHASNIELLDNPGCKEVNAVNCNTSWKITLFMKYSSYREDVLKGGDVV
RLFHAEQEKFLTCDEYEKKQHIFLRTTLRQSATSATSSKALWEIEVVHHDPCRGGAGQWN
SLFRFKHLATGNYLAAELNPDYRDAQNEGKNVRDGVPPTSKKKRQAGEKIMYTLVSVPHG
NDIASLFELDATTLQRADCLVPRNSYVRLRHLCTNTWVTSTSIPIDTDEERPVMLKIGTC
QTKEDKEAFAIVSVPLSEVRDLDFANDANKVLATTVKKLENGTITQNERRFVTKLLEDLI
FFVADVPNNGQEVLDVVITKPNRERQKLMREQNILAQVFGILKAPFKEKAGEGSMLRLED
LGDQRYAPYKYMLRLCYRVLRHSQQDYRKNQEYIAKNFCVMQSQIGYDILAEDTITALLH
NNRKLLEKHITAKEIETFVSLLRRNREPRFLDYLSDLCVSNTTAIPVTQELICKFMLSPG
NADILIQTKVVSMQADNPMESSILSDDIDDEEVWLYWIDSNKEPHGKAIRHLAQEAKEGT
KADLEVLTYYRYQLNLFARMCLDRQYLAINQISTQLSVDLILRCVSDESLPFDLRASFCR
LMLHMHVDRDPQESVVPVRYARLWTEIPTKITIHEYDSITDSSRNDMKRKFALTMEFVEE
YLKEVVNQPFPFGDKEKNKLTFEVVHLARNLIYFGFYSFSELLRLTRTLLAILDIVQAPM
SSYFERLSKFQDGGNNVMRTIHGVGEMMTQMVLSRGSIFPMSVPDVPPSIHPSKQGSPTE
HEDVTVMDTKLKIIEILQFILSVRLDYRISYMLSIYKKEFGEDNDNAETSASGSPDTLLP
SAIVPDIDEIAAQAETMFAGRKEKNPVQLDDEGGRTFLRVLIHLIMHDYPPLLSGALQLL
FKHFSQRAEVLQAFKQVQLLVSNQDVDNYKQIKADLDQLRLTVEKSELWVEKSSNYENGE
IGESQVKGGEEPIEESNILSPVQDGTKKPQIDSNKSNNYRIVKEILIRLSKLCVQNKKCR
NQHQRLLKNMGAHSVVLDLLQIPYEKNDEKMNEVMNLAHTFLQNFCRGNPQNQVLLHKHL
NLFLTPGLLEAETMRHIFMNNYHLCNEISERVVQHFVHCIETHGRHVEYLRFLQTIVKAD
GKYVKKCQDMVMTELINGGEDVLIFYNDRASFPILLHMMCSERDRGDESGPLAYHITLVE
LLAACTEGKNVYTEIKCNSLLPLDDIVRVVTHDDCIPEVKIAYVNFVNHCYVDTEVEMKE
IYTSNHIWKLFENFLVDMARVCNTTTDRKHADIFLEKCVTESIMNIVSGFFNSPFSDNST
SLQTHQPVFIQLLQSAFRIYNCTWPNPAQKASVESCIRTLAEVAKNRGIAIPVDLDSQVN
TLFMKSHSNMVQRAAMGWRLSARSGPRFKEALGGPAWDYRNIIEKLQDVVASLEHQFSPM
MQAEFSVLVDVLYSPELLFPEGSDARIRCGAFMSKLINHTKKLMEKEEKLCIKILQTLRE
MLEKKDSFVEEGNTLRKILLNRYFKGDYSIGVNGHLSGAYSKTAQVGGSFSGQDSDKMGI
SMSDIQCLLDKEGASELVIDVIVNTKNDRIFSEGIFLGIALLEGGNTQTQYSFYQQLHEQ
KKSEKFFKVLYDRMKAAQKEIRSTVTVNTIDLGNKKRDDDNELMTSGPRMRVRDSTLHLK
EGMKGQLTEASSATSKAYCVYRREMDPEIDIMCTGPEAGNTEEKSAEEVTMSPAIAIMQP
ILRFLQLLCENHNRELQNFLRNQNNKTNYNLVCETLQFLDCICGSTTGGLGLLGLYINEK
NVALVNQNLESLTEYCQGPCHENQTCIATHESNGIDIIIALILNDINPLGKYRMDLVLQL
KNNASKLLLAIMESRHDSENAERILFNMRPRELVDVMKNAYNQGLECDHGDDEGGDDGVS
PKDVGHNIYILAHQLARHNKLLQQMLKPGSDPDEGDEALKYYANHTAQIEIVRHDRTMEQ
IVFPVPNICEYLTRESKCRVFNTTERDEQGSKVNDFFQQTEDLYNEMKWQKKIRNNPALF
WFSRHISLWGSISFNLAVFINLAVALFYPFGDDGDEGTLSPLFSVLLWIAVAICTSMLFF
FSKPVGIRPFLVSIMLRSIYTIGLGPTLILLGAANLCNKIVFLVSFVGNRGTFTRGYRAV
ILDMAFLYHVAYVLVCMLGLFVHEFFYSFLLFDLVYREETLLNVIKSVTRNGRSIILTAV
LALILVYLFSIIGFLFLKDDFTMEVDRLKNRTPVTGSHQVPTMTLTTMMEACAKENCSPT
IPASNTADEEYEDGIERTCDTLLMCIVTVLNQGLRNGGGVGDVLRRPSKDEPLFAARVVY
DLLFYFIVIIIVLNLIFGVIIDTFADLRSEKQKKEEILKTTCFICGLERDKFDNKTVSFE
EHIKSEHNMWHYLYFIVLVKVKDPTEYTGPESYVAQMIVEKNLDWFPRMRAMSLVSNEGD
SEQNEIRSLQEKLESTMSLVKQLSGQLAELKEQMTEQRKNKQRLGFLGSNTPHVNHHMPP
H
NT seq 8106 nt NT seq  +upstreamnt  +downstreamnt
atgactgagaaaatgtccagcttcctctacataggggacatcgtgtccctgtacgcggag
ggctcggtcaacggcttcatcagcaccttggggttagtggatgacagatgtgtggtgcac
ccagaggccggggaccttgccaaccctcccaagaagttcagagactgccttttcaaggtg
tgccctatgaacagatattctgcccagaagcaatattggaaagcaaagcaagccaaacaa
gggaaccacaccgaggcagccttgctgaagaaactacagcacgctgcagaactggaacaa
aaacaaaatgaatcggagaataagaaactgttgggagaaattgtaaaatacagtaatgtt
atacaactactgcatataaaaagcaacaaatatcttactgtcaacaagagattacctgct
ttactggagaagaatgccatgcgtgtgtccttggatgctgcaggaaatgaagggtcttgg
ttttatattcatccgttctggaaactgagaagcgagggtgacaatattgttgtaggagat
aaagttgttttgatgcctgtgaatgcagggcagccactacatgccagcaacatagagctt
cttgataacccagggtgtaaagaggtgaatgctgtcaattgcaacaccagctggaaaatc
actttattcatgaaatatagttcctatcgagaggatgtattaaaaggaggggacgttgtt
agattatttcatgcggaacaagagaagtttttgacttgtgatgaatatgagaaaaaacag
cacattttccttcgtacgaccttgcgccaatcagctacttctgctactagttctaaagca
ctctgggaaatagaggtggttcatcatgacccatgccgtgggggtgcaggacagtggaac
agcttgttcagatttaagcatcttgcaactggaaactatttagctgcagagcttaatcct
gattatcgagatgcccaaaatgaaggaaaaaatgtgagagatggagtccctccaacttca
aagaaaaaacgccaggcaggggagaagatcatgtatactttggtttcagtcccgcatggc
aatgacattgcatccctttttgaactagatgccacaactcttcagagagctgactgcctg
gttccaaggaactcatatgttcggttaaggcatttatgcaccaacacatgggtaaccagt
actagtatccccatagacacagatgaagagaggcctgttatgttaaagattggaacctgc
caaaccaaagaagataaagaagcgttcgcaatcgtgtctgttccactgtctgaagttcga
gacttagactttgccaatgatgccaataaagtactagcgaccacagttaaaaagctagaa
aacggcacaataactcagaatgaaaggaggtttgtaaccaaattattggaagatctcata
ttctttgttgctgatgtgcctaataatggacaagaagttctggatgtggttatcactaag
ccaaaccgagagcgtcaaaaattgatgagggaacaaaacatactggcacaggtatttgga
attcttaaagcaccctttaaagagaaagcaggagaaggctcgatgctgagacttgaagat
ctgggggatcaaagatatgcaccctacaagtacatgctgcggctctgttaccgcgtcctg
agacactcgcagcaggattaccggaaaaatcaggaatatattgctaagaatttctgtgtc
atgcagtcccagattggctatgatattttggcagaagatactatcacagctttgttgcac
aacaacagaaaactactagagaaacatatcacagcaaaagaaatagaaacatttgtcagt
ttactcaggagaaatcgggagccaaggtttttggattatttgtcagatctgtgtgtgtct
aataccactgctatccctgtaactcaagaactcatctgtaaatttatgttgagtccaggc
aatgcagacattctcattcaaactaaggtggtctcaatgcaagcagacaaccccatggag
agctccatcctttcagatgacattgatgatgaagaagtttggctctattggattgacagc
aacaaggaacctcatggcaaagctatcaggcaccttgctcaagaggcaaaagaaggcacc
aaagctgacttagaagttcttacctattacaggtaccagctaaacctctttgcaaggatg
tgcttggatcgccagtatctggccataaaccagatttctacacagctgtctgtagacctg
atcctgcggtgtgtgtcggatgagagcctgccgttcgacctccgagcgtccttctgtcgc
ctcatgctccacatgcacgttgaccgggatccccaggagtccgtggtgcctgttcgctat
gccaggctctggacagaaatccccacaaagatcacaattcatgaatatgattctataaca
gactcttccagaaatgatatgaagaggaaatttgccctgacaatggaatttgttgaagaa
tatttgaaagaagttgtaaaccagccctttccttttggggataaagaaaaaaataaactg
acatttgaggtggtccacttggctcggaatcttatatactttggattttatagtttcagt
gagttattaaggctaacaagaacacttctggctattttagacattgtacaggcccccatg
tcatcatactttgaaagattaagcaaatttcaagatggaggaaacaatgtgatgagaacc
attcatggggtgggagagatgatgacccagatggtactcagtagaggctccatcttcccc
atgagcgtgccggatgtgccacccagcatccacccgagcaagcaagggagccccaccgag
cacgaggatgtgactgtgatggacaccaagctgaagatcattgagattttgcagtttatc
ctgagtgtcagactggattataggatctcatatatgctgtcaatatataagaaggagttt
ggagaggacaatgacaatgcggagacatctgccagtggatctccagacactttactacca
tcagctattgttcctgatatagatgaaattgcagctcaggcagaaactatgtttgcggga
agaaaagaaaaaaatccagttcaacttgacgatgaaggaggcaggacgtttttacgggtc
ctcattcatctgatcatgcacgactacccgcctttgctgtctggagccctgcagctgttg
tttaagcacttcagccagagggcagaggttttacaggcatttaagcaggtgcaattactg
gtgtctaatcaagacgtagataactacaagcaaatcaaggcagatctagaccagcttcga
ctgacagtagaaaagtctgagctatgggtggagaagagcagcaactatgagaatggagaa
ataggggaaagtcaagtgaaaggtggtgaagagccaattgaggaatcaaacattttaagt
ccagtgcaggatggaacaaagaaacctcagattgacagcaacaagagcaataactaccgg
attgtaaaggagattttgatcaggctaagtaaactctgtgtgcagaataaaaagtgtcgg
aatcaacatcaacgattactgaaaaatatgggggcgcattcggtggtgttggatcttctg
cagataccctatgaaaagaatgatgaaaagatgaatgaagtaatgaatctagcccataca
tttctgcagaatttctgtcgaggaaatccacagaatcaagttcttcttcataaacatctg
aatttgtttttaactccaggtctccttgaagcagaaaccatgcggcacatcttcatgaac
aattaccatctgtgcaacgaaattagcgagagagttgtacaacactttgtgcactgcatt
gagacacatggccgccacgtggagtacctgaggtttttgcaaacaattgtaaaagcagat
ggtaaatatgtgaagaaatgccaggatatggtaatgacagagttgataaatgggggtgaa
gacgtgctgatattttacaatgatagagcatcatttccaatccttctccatatgatgtgt
tcagagagagaccgaggggatgagagtggccccttagcctaccacatcaccctggtggag
ttgctggcagcatgcacagaggggaaaaatgtctacactgaaatcaagtgtaattccctt
ctcccgctggacgacatagtgagggtggtgacccatgacgactgcatccctgaggttaaa
attgcttatgtgaactttgttaatcactgttatgttgacactgaagtggaaatgaaagaa
atctatacaagtaaccacatttggaaattatttgagaacttcttggtggatatggcaagg
gtttgcaacacaactacagacaggaaacatgcagacatctttttggaaaagtgtgttact
gagtcaataatgaatattgtgagcggcttctttaattctcccttttcagacaatagtacc
agcctccagacacatcagccagtttttattcagctactgcaatctgccttcagaatttac
aattgcacctggccaaacccagcgcagaaagcctcagtggaatcctgtatcagaactttg
gctgaagtggcaaaaaatcgtggaattgccattccagtggatttggacagccaagttaat
actcttttcatgaagagccattcaaatatggtgcagagagcagcaatgggttggagacta
tcagctcgctctgggccacgctttaaggaagctcttggagggcctgcttgggattacaga
aatattattgaaaagttacaggatgtagtggcctccttggagcaccagttcagcccaatg
atgcaggctgaattctcagtgttggttgatgtattgtacagtccagaactgctgttccct
gagggaagcgatgcaagaataagatgtggcgctttcatgtcgaagttgattaatcataca
aagaaactaatggagaaagaagaaaaactgtgcattaaaattcttcagacattacgagaa
atgttagagaagaaagacagctttgtggaagagggtaacacattaagaaagatacttctg
aatcgatactttaaaggtgattatagtattggtgtgaatggacacctatcaggagcctac
tccaaaactgcacaggtgggaggaagcttttctggacaagattcagataagatggggata
tcaatgtcagacattcagtgtctgctggataaagaaggtgcatcagaacttgtcatcgat
gttatagtgaacaccaaaaatgacagaattttttcagaaggcattttcctcggcattgcc
ttgcttgaaggaggaaatacacaaacacagtattctttctaccagcagttgcatgaacaa
aaaaagtcagaaaaattctttaaagttctctatgatcgaatgaaggctgctcagaaagaa
ataagatcaacagtgacagttaataccatagatttaggtaacaaaaaaagggacgatgac
aatgaattgatgacatctggtccacgaatgagagtaagagattcaacactacatttaaaa
gagggaatgaaagggcaattaacagaagcttcttcagcaacatccaaagcatattgtgta
tacagaagagaaatggatccagaaatagacattatgtgcacaggaccagaagcgggaaac
actgaggaaaaatccgcagaggaagtaacaatgagtcccgcaattgccatcatgcagcca
atactgagatttcttcagttactgtgtgagaatcacaaccgggaattgcagaacttcttg
aggaatcaaaacaacaaaacaaattacaacctagtctgtgagacccttcagtttctggac
tgcatttgtggaagtacaaccggtggcctgggcctgttgggtctctacatcaatgagaag
aatgtagcgctggtcaaccagaacctggagagcttgactgagtattgccagggcccttgc
catgaaaatcagacctgtatcgctacacatgagtctaatgggattgatatcatcattgct
ttgattctgaatgacataaaccctcttggtaaataccgaatggacctggtgctccagcta
aagaacaatgcatctaaacttttgctggccattatggaaagcagacatgacagtgagaat
gcagaaagaattctttttaacatgagacccagagaactggtggatgtgatgaagaatgcc
tataaccaaggattggaatgtgaccatggggatgatgagggtggagatgatggtgtttct
ccaaaagatgttggacacaatatctatattctggcccatcagttggcccgccacaataaa
ctgttgcagcagatgctcaaaccaggatcggatccagatgaaggagatgaagccttaaag
tattatgccaaccacactgcacagattgagattgtccggcatgataggaccatggaacaa
atagtttttcctgtccccaatatatgtgaatacctcactcgagaatccaagtgccgtgtg
ttcaatacaactgaaagggatgaacaaggaagtaaagtgaatgactttttccagcaaaca
gaagatctctacaatgaaatgaagtggcagaagaaaatcaggaataaccctgcactgttc
tggttctcgaggcacatctctctctgggggagcatttccttcaacctggctgtgttcatc
aatttagctgttgctctcttctacccatttggggatgatggagatgaaggtacactttct
ccattgttctcggttcttctttggatagcagttgcgatctgcacatctatgctgtttttc
ttctccaagcctgtgggtattcggccgtttcttgtatcaataatgctcagatcaatatat
acaataggtcttgggcctacattaatacttcttggtgcagctaatctttgtaataaaatt
gtttttctggtgagttttgttggaaatcgtggcacgttcacccgtgggtaccgagcagtc
atcctggatatggcctttctctatcacgtggcgtatgtcctggtttgcatgctgggcctt
tttgtccatgaattcttctatagcttcctgctttttgatttggtgtacagggaagagact
ttgctgaatgtcataaaaagtgtcacacgaaatggccgctctattattctaactgcagtc
ctggctctcatcctcgtctacctgttttccattattgggttcctttttttgaaggatgac
ttcactatggaagttgataggctgaaaaaccgaactcctgttacaggcagtcatcaagtg
cctactatgactttaactaccatgatggaagcatgtgccaaggagaactgttcacccaca
attccagcttcaaatacagctgatgaagagtatgaagatggaattgaaaggacgtgtgac
actctccttatgtgcattgtcaccgtgctgaaccagggcctcaggaatggcggtggtgtg
ggggatgtgctaagaaggccatcgaaagatgagcccttgtttgctgcccgagtggtttat
gaccttcttttttatttcattgttatcattattgttctgaacttgatttttggtgttatc
atcgatacttttgctgatctcagaagcgaaaaacagaaaaaagaagaaattctaaagaca
acttgtttcatctgtggacttgagagagacaagtttgataataaaacggtttcatttgag
gagcacattaagtcagaacacaatatgtggcattatttgtacttcatagtcctggtgaaa
gttaaagacccaacagaatacactggacctgaaagttatgtggctcaaatgattgtggag
aagaatttggattggtttcctcggatgcgagccatgtccctcgttagcaatgaaggcgac
agtgagcaaaatgaaattcggagccttcaggagaagttggaatcgaccatgagtctggtc
aaacagctgtcgggtcagctggcggagctcaaggagcagatgacagaacaaaggaagaat
aagcagagactgggcttcctcggatcaaacacaccccatgtgaatcatcacatgccacca
cactga

DBGET integrated database retrieval system