KEGG   Homo sapiens (human): 3710Help
Entry
3710              CDS       T01001                                 

Gene name
ITPR3, IP3R, IP3R3
Definition
inositol 1,4,5-trisphosphate receptor, type 3
Orthology
K04960  
inositol 1,4,5-triphosphate receptor type 3
Organism
hsa  Homo sapiens (human)
Pathway
Calcium signaling pathway
Phosphatidylinositol signaling system
Oocyte meiosis
Vascular smooth muscle contraction
Gap junction
Circadian entrainment
Long-term potentiation
Retrograde endocannabinoid signaling
Glutamatergic synapse
Cholinergic synapse
Serotonergic synapse
Dopaminergic synapse
Long-term depression
Taste transduction
Inflammatory mediator regulation of TRP channels
Insulin secretion
GnRH signaling pathway
Estrogen signaling pathway
Thyroid hormone synthesis
Oxytocin signaling pathway
Salivary secretion
Gastric acid secretion
Pancreatic secretion
Alzheimer's disease
Proteoglycans in cancer
Disease
H00408  
Type I diabetes mellitus
Class
Environmental Information Processing; Signal transduction; Calcium signaling pathway [PATH:hsa04020]
Environmental Information Processing; Signal transduction; Phosphatidylinositol signaling system [PATH:hsa04070]
Cellular Processes; Cell growth and death; Oocyte meiosis [PATH:hsa04114]
Cellular Processes; Cell communication; Gap junction [PATH:hsa04540]
Organismal Systems; Endocrine system; Insulin secretion [PATH:hsa04911]
Organismal Systems; Endocrine system; GnRH signaling pathway [PATH:hsa04912]
Organismal Systems; Endocrine system; Estrogen signaling pathway [PATH:hsa04915]
Organismal Systems; Endocrine system; Oxytocin signaling pathway [PATH:hsa04921]
Organismal Systems; Endocrine system; Thyroid hormone synthesis [PATH:hsa04918]
Organismal Systems; Circulatory system; Vascular smooth muscle contraction [PATH:hsa04270]
Organismal Systems; Digestive system; Salivary secretion [PATH:hsa04970]
Organismal Systems; Digestive system; Gastric acid secretion [PATH:hsa04971]
Organismal Systems; Digestive system; Pancreatic secretion [PATH:hsa04972]
Organismal Systems; Nervous system; Glutamatergic synapse [PATH:hsa04724]
Organismal Systems; Nervous system; Cholinergic synapse [PATH:hsa04725]
Organismal Systems; Nervous system; Dopaminergic synapse [PATH:hsa04728]
Organismal Systems; Nervous system; Serotonergic synapse [PATH:hsa04726]
Organismal Systems; Nervous system; Long-term potentiation [PATH:hsa04720]
Organismal Systems; Nervous system; Long-term depression [PATH:hsa04730]
Organismal Systems; Nervous system; Retrograde endocannabinoid signaling [PATH:hsa04723]
Organismal Systems; Sensory system; Taste transduction [PATH:hsa04742]
Organismal Systems; Sensory system; Inflammatory mediator regulation of TRP channels [PATH:hsa04750]
Organismal Systems; Environmental adaptation; Circadian entrainment [PATH:hsa04713]
Human Diseases; Cancers; Proteoglycans in cancer [PATH:hsa05205]
Human Diseases; Neurodegenerative diseases; Alzheimer's disease [PATH:hsa05010]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
6p21
AA seq 2671 aa AA seqDB search
MSEMSSFLHIGDIVSLYAEGSVNGFISTLGLVDDRCVVEPAAGDLDNPPKKFRDCLFKVC
PMNRYSAQKQYWKAKQTKQDKEKIADVVLLQKLQHAAQMEQKQNDTENKKVHGDVVKYGS
VIQLLHMKSNKYLTVNKRLPALLEKNAMRVTLDATGNEGSWLFIQPFWKLRSNGDNVVVG
DKVILNPVNAGQPLHASNYELSDNAGCKEVNSVNCNTSWKINLFMQFRDHLEEVLKGGDV
VRLFHAEQEKFLTCDEYKGKLQVFLRTTLRQSATSATSSNALWEVEVVHHDPCRGGAGHW
NGLYRFKHLATGNYLAAEENPSYKGDASDPKAAGMGAQGRTGRRNAGEKIKYCLVAVPHG
NDIASLFELDPTTLQKTDSFVPRNSYVRLRHLCTNTWIQSTNVPIDIEEERPIRLMLGTC
PTKEDKEAFAIVSVPVSEIRDLDFANDASSMLASAVEKLNEGFISQNDRRFVIQLLEDLV
FFVSDVPNNGQNVLDIMVTKPNRERQKLMREQNILKQVFGILKAPFREKGGEGPLVRLEE
LSDQKNAPYQHMFRLCYRVLRHSQEDYRKNQEHIAKQFGMMQSQIGYDILAEDTITALLH
NNRKLLEKHITKTEVETFVSLVRKNREPRFLDYLSDLCVSNHIAIPVTQELICKCVLDPK
NSDILIRTELRPVKEMAQSHEYLSIEYSEEEVWLTWTDKNNEHHEKSVRQLAQEARAGNA
HDENVLSYYRYQLKLFARMCLDRQYLAIDEISQQLGVDLIFLCMADEMLPFDLRASFCHL
MLHVHVDRDPQELVTPVKFARLWTEIPTAITIKDYDSNLNASRDDKKNKFANTMEFVEDY
LNNVVSEAVPFANEEKNKLTFEVVSLAHNLIYFGFYSFSELLRLTRTLLGIIDCVQGPPA
MLQAYEDPGGKNVRRSIQGVGHMMSTMVLSRKQSVFSAPSLSAGASAAEPLDRSKFEENE
DIVVMETKLKILEILQFILNVRLDYRISYLLSVFKKEFVEVFPMQDSGADGTAPAFDSTT
ANMNLDRIGEQAEAMFGVGKTSSMLEVDDEGGRMFLRVLIHLTMHDYAPLVSGALQLLFK
HFSQRQEAMHTFKQVQLLISAQDVENYKVIKSELDRLRTMVEKSELWVDKKGSGKGEEVE
AGAAKDKKERPTDEEGFLHPPGEKSSENYQIVKGILERLNKMCGVGEQMRKKQQRLLKNM
DAHKVMLDLLQIPYDKGDAKMMEILRYTHQFLQKFCAGNPGNQALLHKHLHLFLTPGLLE
AETMQHIFLNNYQLCSEISEPVLQHFVHLLATHGRHVQYLDFLHTVIKAEGKYVKKCQDM
IMTELTNAGDDVVVFYNDKASLAHLLDMMKAARDGVEDHSPLMYHISLVDLLAACAEGKN
VYTEIKCTSLLPLEDVVSVVTHEDCITEVKMAYVNFVNHCYVDTEVEMKEIYTSNHIWTL
FENFTLDMARVCSKREKRVADPTLEKYVLSVVLDTINAFFSSPFSENSTSLQTHQTIVVQ
LLQSTTRLLECPWLQQQHKGSVEACIRTLAMVAKGRAILLPMDLDAHISSMLSSGASCAA
AAQRNASSYKATTRAFPRVTPTANQWDYKNIIEKLQDIITALEERLKPLVQAELSVLVDV
LHWPELLFLEGSEAYQRCESGGFLSKLIQHTKDLMESEEKLCIKVLRTLQQMLLKKTKYG
DRGNQLRKMLLQNYLQNRKSTSRGDLPDPIGTGLDPDWSAIAATQCRLDKEGATKLVCDL
ITSTKNEKIFQESIGLAIHLLDGGNTEIQKSFHNLMMSDKKSERFFKVLHDRMKRAQQET
KSTVAVNMNDLGSQPHEDREPVDPTTKGRVASFSIPGSSSRYSLGPSLRRGHEVSERVQS
SEMGTSVLIMQPILRFLQLLCENHNRDLQNFLRCQNNKTNYNLVCETLQFLDIMCGSTTG
GLGLLGLYINEDNVGLVIQTLETLTEYCQGPCHENQTCIVTHESNGIDIITALILNDISP
LCKYRMDLVLQLKDNASKLLLALMESRHDSENAERILISLRPQELVDVIKKAYLQEEERE
NSEVSPREVGHNIYILALQLSRHNKQLQHLLKPVKRIQEEEAEGISSMLSLNNKQLSQML
KSSAPAQEEEEDPLAYYENHTSQIEIVRQDRSMEQIVFPVPGICQFLTEETKHRLFTTTE
QDEQGSKVSDFFDQSSFLHNEMEWQRKLRSMPLIYWFSRRMTLWGSISFNLAVFINIIIA
FFYPYMEGASTGVLDSPLISLLFWILICFSIAALFTKRYSIRPLIVALILRSIYYLGIGP
TLNILGALNLTNKIVFVVSFVGNRGTFIRGYKAMVMDMEFLYHVGYILTSVLGLFAHELF
YSILLFDLIYREETLFNVIKSVTRNGRSILLTALLALILVYLFSIVGFLFLKDDFILEVD
RLPNNHSTASPLGMPHGAAAFVDTCSGDKMDCVSGLSVPEVLEEDRELDSTERACDTLLM
CIVTVMNHGLRNGGGVGDILRKPSKDESLFPARVVYDLLFFFIVIIIVLNLIFGVIIDTF
ADLRSEKQKKEEILKTTCFICGLERDKFDNKTVSFEEHIKLEHNMWNYLYFIVLVRVKNK
TDYTGPESYVAQMIKNKNLDWFPRMRAMSLVSNEGEGEQNEIRILQDKLNSTMKLVSHLT
AQLNELKEQMTEQRKRRQRLGFVDVQNCISR
NT seq 8016 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaaatgtccagctttcttcacatcggggacatcgtctccctgtacgccgagggc
tccgtcaatggcttcatcagcactttggggctggtggatgaccgctgtgtggtggagccc
gcggccggggacctggacaacccccctaagaagttccgtgactgcctcttcaaggtgtgc
cccatgaaccgctactcggcccagaagcagtactggaaggccaagcagactaagcaggac
aaggagaagatcgctgatgtggtgttgctgcagaagctgcagcatgcggcgcagatggag
cagaagcaaaatgacacggagaacaagaaggtgcatggggatgtcgtgaagtatggcagt
gtgatccagctcctgcacatgaagagcaacaagtacctgacagtgaacaagcggcttccg
gccttgctggagaagaacgccatgcgggtgactctggatgccacaggcaacgagggttcc
tggctcttcatccagcccttctggaagctgcggagcaacggggacaacgtggtcgtgggg
gacaaggtgatcctgaatcctgtcaatgccgggcagcctctgcatgccagcaattacgag
ctcagcgacaacgccggctgcaaggaggtcaattctgtgaactgcaacaccagctggaag
atcaacctgtttatgcagtttcgggaccacctggaggaggtgttgaaagggggagacgtg
gtgcggctgttccatgcggagcaggagaagttcctgacgtgtgacgagtacaagggcaag
ctgcaggtgttcctgcgaactacactgcgccagtctgccacctcggccaccagctccaat
gctctctgggaggtggaggtggtccaccacgacccctgccgtggaggagctgggcactgg
aatggcttgtaccgcttcaagcacctggctacaggcaactacctggctgctgaggagaac
cccagttacaaaggtgatgcctcagatcccaaggcagcaggaatgggggcacagggccgc
acaggccgcaggaatgctggggagaagatcaagtactgcctggtggctgtgcctcatggc
aatgacatcgcctctctctttgagctggaccccaccaccttgcagaaaaccgactctttc
gtgccccggaactcgtacgtccggctgcggcacctctgcaccaacacgtggattcagagc
accaatgtgcccattgacatcgaggaggagcggcccatccggctcatgctgggcacctgc
cccaccaaggaggacaaggaggcctttgccatcgtgtcagtgcccgtgtctgagatccga
gacctggactttgccaatgacgccagctccatgctggccagtgccgtggagaaactcaac
gagggcttcatcagccagaatgaccgcaggtttgtcatccagctgctggaagacctggtg
ttctttgtcagcgatgtccccaacaatgggcagaatgtcctggacatcatggtcactaag
cccaaccgggaacggcagaagctgatgagggagcagaacatcctcaaacaggtctttggc
attctgaaggccccgttccgtgagaaggggggtgaaggtcccctggtgcggctggaggag
ctgtcagaccagaagaacgccccctaccagcacatgttccgcctgtgctaccgcgtgttg
cggcattcccaggaggactaccgcaagaaccaggagcacattgccaagcagtttgggatg
atgcagtcccagattggctacgacatcctggccgaggacaccatcactgccctgctgcac
aacaaccgcaagctcctggaaaagcacatcaccaagaccgaggtggagaccttcgtcagc
cttgtgcgcaagaaccgggagcccaggttcctggactacctctctgacctgtgtgtgtcc
aaccacatcgccatccccgtcacccaagagctcatctgcaagtgtgtgctggaccccaag
aacagtgacattctcatccggaccgagcttcggcccgtgaaggagatggcccaatcccac
gagtacctgagcatcgagtactcagaagaggaagtgtggctcacgtggactgacaagaat
aacgagcatcatgagaagagtgtgaggcagctggcccaggaggcgcgggccggcaacgcc
cacgacgagaatgtgctcagctactacaggtaccagctgaagctctttgcccgcatgtgc
ttggaccgccagtacttggccatcgacgagatctcccagcagctgggcgtggacctgatt
ttcctgtgcatggcagacgagatgctgccctttgacctgcgcgcctccttctgccacctg
atgctgcacgtgcacgtggaccgtgacccccaggagctggtcacgccggtcaagtttgcc
cgtctctggactgagatccccacagccatcaccatcaaggactatgattccaacctcaac
gcgtcccgagatgacaagaagaacaagtttgccaacaccatggagttcgtggaggactac
ctcaacaatgtagtcagcgaggccgtgccctttgccaacgaggagaagaacaagctcact
tttgaggtggtcagcctggcgcacaatctcatctacttcggcttctacagcttcagcgag
ctgctgcggctcactcgcacactgctgggcatcatcgactgtgtgcaggggcccccggcc
atgctgcaggcctatgaggaccccggtggcaagaatgtgcggcggtccatccagggcgtg
gggcacatgatgtccaccatggtgctgagccgcaagcagtccgtcttcagtgcccccagc
ctgtctgctggggccagtgctgctgagccgctggacagaagcaagtttgaggagaatgag
gacattgtggtgatggagaccaagctgaagatcctggaaatccttcagttcatcctcaat
gtccgcctggattaccgcatatcctacctgctgtctgtcttcaagaaggagtttgtggag
gtgtttcccatgcaggacagtggggctgatggcacagcccctgccttcgactctaccact
gccaacatgaacctggatcgcatcggggagcaggcggaggccatgtttggagtggggaag
acaagcagcatgctggaggtggatgacgagggcggccgcatgttcctgcgcgtgctcatc
cacctcaccatgcacgactatgcgccgctggtctcgggtgccctgcagctgctcttcaag
cacttcagccagcgccaggaggccatgcacaccttcaagcaggttcagctgctgatctca
gcgcaggacgtggagaactacaaggtgatcaagtcggagctggaccggctgcggaccatg
gtggagaagtcagagctgtgggtggacaagaagggcagtggcaagggtgaggaggtggag
gcaggcgccgccaaggacaagaaagagcgtcccacggacgaggagggctttctgcaccca
ccaggggagaaaagcagtgagaactaccagatcgtcaagggcatcctggaaaggctgaac
aagatgtgcggggttggggagcaaatgaggaagaagcagcaacggctgctgaagaacatg
gatgcccacaaggtcatgctggacctgctgcagatcccctatgacaagggtgatgccaag
atgatggagatcctgcgctacacgcaccagttcctgcagaagttctgtgcagggaacccc
ggcaaccaggccctgctgcacaaacacctgcacctcttcctcacgccagggctcctggag
gcagagaccatgcagcacatcttcctgaacaactatcagctctgctccgagatcagcgag
cctgtgttgcagcacttcgtgcacctgctggccacgcacgggcgccatgtgcagtacctg
gacttcctgcacaccgtcattaaggccgagggcaagtacgtcaagaagtgccaggacatg
atcatgactgagctgaccaatgcaggtgacgatgtggtcgtgttctacaatgataaggca
tcgctggcccacctgctggacatgatgaaggccgcccgcgacggcgtggaggaccacagc
cccctcatgtaccacatttccctggtggacctgctggccgcctgtgccgagggcaaaaac
gtctacactgagatcaagtgcacctccctgctgccgctggaggacgtggtgtctgtggtg
acgcatgaggactgcatcactgaggtgaaaatggcctatgtgaacttcgtgaaccactgc
tacgtggacacggaggtggagatgaaggagatctacaccagcaaccacatctggacgctc
tttgagaacttcaccctggacatggctcgggtctgcagcaagcgtgagaagcgcgtggct
gaccccaccttggagaagtacgtgctgagcgttgtgctggacaccatcaacgccttcttc
agctccccattctctgagaacagcacttccctgcagacacaccagacgattgtggtgcag
ctgctgcagtctaccacacgcctcctcgagtgtccgtggctacagcagcagcacaagggc
tccgtggaggcctgcatccggaccctcgccatggtggccaagggccgggccatcttgctg
cccatggacctggatgcccacatcagctcgatgctcagcagtggagccagctgtgcagct
gccgcccagcggaacgcctccagctacaaggcaaccacgcgggccttcccccgcgtcacc
cccaccgccaaccagtgggactacaagaacatcattgagaagctgcaggacatcatcaca
gccctggaggagcggctgaagcccctggtacaggctgagctgtccgtgctggtggatgtc
ctgcactggcctgagctgctcttcctggagggcagtgaggcctaccagcgctgcgagagt
gggggcttcctgtccaagctgatccagcacaccaaggacctcatggagtcggaggagaag
ctgtgcatcaaggtgctgcggaccctgcagcagatgctgctcaagaagaccaagtacggg
gaccggggcaaccagctgcgcaagatgctgctgcaaaactacctccagaaccggaagtcc
acctcgcggggggaccttcccgaccccataggcactggcctggacccagactggtcggca
atcgcagccacccagtgccggctggacaaggagggggccaccaagttggtatgcgacctc
atcaccagcaccaagaacgagaagatcttccaggagagcatcggcctggccatccacctg
ctggatggtggcaacacagagatccagaaatccttccacaacctgatgatgagtgacaag
aagtcagagcgcttcttcaaggtgctgcacgaccgcatgaagcgggcccagcaggagacc
aagtccacggtggcagtcaacatgaatgacctgggcagccagccacatgaggaccgcgag
ccagtcgaccccaccaccaaaggccgcgtggcctccttctcgatacctggctcctcatcc
cgctactcgctgggccccagcctgcgccgggggcacgaggtgagcgaacgtgtgcagagc
agtgagatgggcacatccgtgctcatcatgcagcccatcctgcgctttctgcagctgctg
tgtgagaaccacaaccgggacctgcagaacttcctgcgctgtcagaacaacaaaaccaac
tacaacttggtatgcgagacgctgcagttcctggacatcatgtgcggcagcaccacgggc
ggcctggggctgctggggctctacatcaatgaggacaacgtgggcctcgtcatccagacc
ttggagaccctcactgagtactgccagggcccctgccatgagaaccagacttgcattgtg
actcacgagtccaatggcatagacatcatcaccgcactgatcctcaatgacatcagcccc
ctgtgcaagtaccgcatggatctggtgctgcagctcaaggacaatgcctccaagctgctc
ctggctctgatggagagccggcatgacagtgaaaatgctgagcgaatcctcatcagcctg
cggccccaggagctggtggacgtcatcaagaaggcctacctgcaggaggaagagcgtgag
aactcggaggtgagcccacgtgaagtgggccataacatctatatcctggcgctgcagctc
tccaggcacaataaacagctgcagcacctgctgaagccggtgaagcgcattcaagaggag
gaggccgagggtatctcttccatgctcagcctcaacaacaagcagctgtcacagatgctc
aagtcctcagcgccagcacaggaggaggaggaagaccccctggcctactatgagaaccac
acgtcccagatcgagattgtgcggcaggaccgcagcatggagcagatcgtgttcccagtg
cccggcatctgccagttcctgacggaggaaaccaagcaccggctcttcaccactactgag
caggacgagcagggcagcaaagtgagcgacttcttcgaccagtcctccttcctgcacaac
gagatggagtggcagcgcaagctccgcagcatgccgctgatctactggttctcccgccgc
atgaccctgtggggcagcatctccttcaacctggccgtgtttatcaacatcatcattgcc
ttcttctacccttacatggagggcgcgtccacaggcgtgctggactcccctctcatctca
ttgctcttctggatcctcatctgcttctccatcgcggccctgttcaccaagcgctacagc
atccgccccctcatcgtggcgctcatcctgcgctccatctactatctgggcatcgggccc
acactcaacatcctgggtgccctcaatctgaccaacaagatcgtgtttgtggtgagcttc
gtgggcaaccgtggcaccttcatccggggctataaggccatggtcatggacatggaattc
ctctaccacgtgggctacatcctgaccagtgtcctgggcctctttgctcatgagctgttc
tacagcatcctgctctttgacctcatctaccgcgaggagacgctgttcaacgtcatcaag
agtgtgacccgcaatggccgctccatcctgctgacagccctgctggccctcatcctggtc
tacctcttctccatcgtcggcttcctcttcctcaaggatgacttcattctcgaggtcgac
cggctgcccaacaaccactccacagccagccccctggggatgccacatggagctgctgca
tttgtggacacctgcagtggggacaagatggactgtgtctcagggctctcggtgcctgag
gtcctggaagaggacagggagctggacagcacagagcgggcctgtgacactctgttgatg
tgcatcgtcactgtcatgaaccatgggctacgcaacggtggtggcgtgggcgacattctc
cgcaagccctccaaagatgagtctctcttcccagcccgagtggtctatgacctcctgttc
ttcttcatcgtcatcatcattgtgctgaacctcatctttggggtaatcatcgacaccttc
gctgacctgcgtagtgagaagcagaagaaggaggagattcttaagacgacatgcttcatc
tgtggtctggagagggacaagtttgataacaagacagtgtcatttgaggaacacatcaag
ctggagcacaacatgtggaactacttgtacttcattgtgctggtccgcgtgaagaacaag
accgactacacgggccctgagagctacgtggcccagatgatcaagaacaagaacctggac
tggttcccccggatgcgggccatgtcccttgtcagcaatgagggcgagggggagcagaat
gagattcggattctccaggacaagctcaactccaccatgaagctggtgtcccacctcact
gcccagctcaacgagctcaaggagcagatgacggagcagcggaaacgcaggcaacgccta
ggctttgtggatgtccagaactgcattagccgctga

DBGET integrated database retrieval system