KEGG   Homo sapiens (human): 3716Help
Entry
3716              CDS       T01001                                 

Gene name
JAK1, JAK1A, JAK1B, JTK3
Definition
Janus kinase 1 (EC:2.7.10.2)
Orthology
K11217  
Janus kinase 1 [EC:2.7.10.2]
Organism
hsa  Homo sapiens (human)
Pathway
PI3K-Akt signaling pathway
Osteoclast differentiation
Signaling pathways regulating pluripotency of stem cells
Jak-STAT signaling pathway
Leishmaniasis
Toxoplasmosis
Tuberculosis
Hepatitis C
Hepatitis B
Measles
Influenza A
HTLV-I infection
Herpes simplex infection
Epstein-Barr virus infection
Pathways in cancer
Viral carcinogenesis
Pancreatic cancer
Drug target
Ruxolitinib: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    3716 (JAK1)
   04151 PI3K-Akt signaling pathway
    3716 (JAK1)
 Cellular Processes
  Cellular commiunity
   04550 Signaling pathways regulating pluripotency of stem cells
    3716 (JAK1)
 Organismal Systems
  Development
   04380 Osteoclast differentiation
    3716 (JAK1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    3716 (JAK1)
   05203 Viral carcinogenesis
    3716 (JAK1)
   05212 Pancreatic cancer
    3716 (JAK1)
  Infectious diseases
   05152 Tuberculosis
    3716 (JAK1)
   05166 HTLV-I infection
    3716 (JAK1)
   05162 Measles
    3716 (JAK1)
   05164 Influenza A
    3716 (JAK1)
   05161 Hepatitis B
    3716 (JAK1)
   05160 Hepatitis C
    3716 (JAK1)
   05168 Herpes simplex infection
    3716 (JAK1)
   05169 Epstein-Barr virus infection
    3716 (JAK1)
   05145 Toxoplasmosis
    3716 (JAK1)
   05140 Leishmaniasis
    3716 (JAK1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     3716 (JAK1)
Protein kinases [BR:hsa01001]
 Tyrosine protein kinases
  JAK family [OT]
   3716 (JAK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1p32.3-p31.3
AA seq 1154 aa AA seqDB search
MQYLNIKEDCNAMAFCAKMRSSKKTEVNLEAPEPGVEVIFYLSDREPLRLGSGEYTAEEL
CIRAAQACRISPLCHNLFALYDENTKLWYAPNRTITVDDKMSLRLHYRMRFYFTNWHGTN
DNEQSVWRHSPKKQKNGYEKKKIPDATPLLDASSLEYLFAQGQYDLVKCLAPIRDPKTEQ
DGHDIENECLGMAVLAISHYAMMKKMQLPELPKDISYKRYIPETLNKSIRQRNLLTRMRI
NNVFKDFLKEFNNKTICDSSVSTHDLKVKYLATLETLTKHYGAEIFETSMLLISSENEMN
WFHSNDGGNVLYYEVMVTGNLGIQWRHKPNVVSVEKEKNKLKRKKLENKHKKDEEKNKIR
EEWNNFSYFPEITHIVIKESVVSINKQDNKKMELKLSSHEEALSFVSLVDGYFRLTADAH
HYLCTDVAPPLIVHNIQNGCHGPICTEYAINKLRQEGSEEGMYVLRWSCTDFDNILMTVT
CFEKSEQVQGAQKQFKNFQIEVQKGRYSLHGSDRSFPSLGDLMSHLKKQILRTDNISFML
KRCCQPKPREISNLLVATKKAQEWQPVYPMSQLSFDRILKKDLVQGEHLGRGTRTHIYSG
TLMDYKDDEGTSEEKKIKVILKVLDPSHRDISLAFFEAASMMRQVSHKHIVYLYGVCVRD
VENIMVEEFVEGGPLDLFMHRKSDVLTTPWKFKVAKQLASALSYLEDKDLVHGNVCTKNL
LLAREGIDSECGPFIKLSDPGIPITVLSRQECIERIPWIAPECVEDSKNLSVAADKWSFG
TTLWEICYNGEIPLKDKTLIEKERFYESRCRPVTPSCKELADLMTRCMNYDPNQRPFFRA
IMRDINKLEEQNPDIVSEKKPATEVDPTHFEKRFLKRIRDLGEGHFGKVELCRYDPEGDN
TGEQVAVKSLKPESGGNHIADLKKEIEILRNLYHENIVKYKGICTEDGGNGIKLIMEFLP
SGSLKEYLPKNKNKINLKQQLKYAVQICKGMDYLGSRQYVHRDLAARNVLVESEHQVKIG
DFGLTKAIETDKEYYTVKDDRDSPVFWYAPECLMQSKFYIASDVWSFGVTLHELLTYCDS
DSSPMALFLKMIGPTHGQMTVTRLVNTLKEGKRLPCPPNCPDEVYQLMRKCWEFQPSNRT
SFQNLIEGFEALLK
NT seq 3465 nt NT seq  +upstreamnt  +downstreamnt
atgcagtatctaaatataaaagaggactgcaatgccatggctttctgtgctaaaatgagg
agctccaagaagactgaggtgaacctggaggcccctgagccaggggtggaagtgatcttc
tatctgtcggacagggagcccctccggctgggcagtggagagtacacagcagaggaactg
tgcatcagggctgcacaggcatgccgtatctctcctctttgtcacaacctctttgccctg
tatgacgagaacaccaagctctggtatgctccaaatcgcaccatcaccgttgatgacaag
atgtccctccggctccactaccggatgaggttctatttcaccaattggcatggaaccaac
gacaatgagcagtcagtgtggcgtcattctccaaagaagcagaaaaatggctacgagaaa
aaaaagattccagatgcaacccctctccttgatgccagctcactggagtatctgtttgct
cagggacagtatgatttggtgaaatgcctggctcctattcgagaccccaagaccgagcag
gatggacatgatattgagaacgagtgtctagggatggctgtcctggccatctcacactat
gccatgatgaagaagatgcagttgccagaactgcccaaggacatcagctacaagcgatat
attccagaaacattgaataagtccatcagacagaggaaccttctcaccaggatgcggata
aataatgttttcaaggatttcctaaaggaatttaacaacaagaccatttgtgacagcagc
gtgtccacgcatgacctgaaggtgaaatacttggctaccttggaaactttgacaaaacat
tacggtgctgaaatatttgagacttccatgttactgatttcatcagaaaatgagatgaat
tggtttcattcgaatgacggtggaaacgttctctactacgaagtgatggtgactgggaat
cttggaatccagtggaggcataaaccaaatgttgtttctgttgaaaaggaaaaaaataaa
ctgaagcggaaaaaactggaaaataaacacaagaaggatgaggagaaaaacaagatccgg
gaagagtggaacaatttttcttacttccctgaaatcactcacattgtaataaaggagtct
gtggtcagcattaacaagcaggacaacaagaaaatggaactgaagctctcttcccacgag
gaggccttgtcctttgtgtccctggtagatggctacttccggctcacagcagatgcccat
cattacctctgcaccgacgtggcccccccgttgatcgtccacaacatacagaatggctgt
catggtccaatctgtacagaatacgccatcaataaattgcggcaagaaggaagcgaggag
gggatgtacgtgctgaggtggagctgcaccgactttgacaacatcctcatgaccgtcacc
tgctttgagaagtctgagcaggtgcagggtgcccagaagcagttcaagaactttcagatc
gaggtgcagaagggccgctacagtctgcacggttcggaccgcagcttccccagcttggga
gacctcatgagccacctcaagaagcagatcctgcgcacggataacatcagcttcatgcta
aaacgctgctgccagcccaagccccgagaaatctccaacctgctggtggctactaagaaa
gcccaggagtggcagcccgtctaccccatgagccagctgagtttcgatcggatcctcaag
aaggatctggtgcagggcgagcaccttgggagaggcacgagaacacacatctattctggg
accctgatggattacaaggatgacgaaggaacttctgaagagaagaagataaaagtgatc
ctcaaagtcttagaccccagccacagggatatttccctggccttcttcgaggcagccagc
atgatgagacaggtctcccacaaacacatcgtgtacctctatggcgtctgtgtccgcgac
gtggagaatatcatggtggaagagtttgtggaagggggtcctctggatctcttcatgcac
cggaaaagcgatgtccttaccacaccatggaaattcaaagttgccaaacagctggccagt
gccctgagctacttggaggataaagacctggtccatggaaatgtgtgtactaaaaacctc
ctcctggcccgtgagggcatcgacagtgagtgtggcccattcatcaagctcagtgacccc
ggcatccccattacggtgctgtctaggcaagaatgcattgaacgaatcccatggattgct
cctgagtgtgttgaggactccaagaacctgagtgtggctgctgacaagtggagctttgga
accacgctctgggaaatctgctacaatggcgagatccccttgaaagacaagacgctgatt
gagaaagagagattctatgaaagccggtgcaggccagtgacaccatcatgtaaggagctg
gctgacctcatgacccgctgcatgaactatgaccccaatcagaggcctttcttccgagcc
atcatgagagacattaataagcttgaagagcagaatccagatattgtttcagaaaaaaaa
ccagcaactgaagtggaccccacacattttgaaaagcgcttcctaaagaggatccgtgac
ttgggagagggccactttgggaaggttgagctctgcaggtatgaccccgaaggggacaat
acaggggagcaggtggctgttaaatctctgaagcctgagagtggaggtaaccacatagct
gatctgaaaaaggaaatcgagatcttaaggaacctctatcatgagaacattgtgaagtac
aaaggaatctgcacagaagacggaggaaatggtattaagctcatcatggaatttctgcct
tcgggaagccttaaggaatatcttccaaagaataagaacaaaataaacctcaaacagcag
ctaaaatatgccgttcagatttgtaaggggatggactatttgggttctcggcaatacgtt
caccgggacttggcagcaagaaatgtccttgttgagagtgaacaccaagtgaaaattgga
gacttcggtttaaccaaagcaattgaaaccgataaggagtattacaccgtcaaggatgac
cgggacagccctgtgttttggtatgctccagaatgtttaatgcaatctaaattttatatt
gcctctgacgtctggtcttttggagtcactctgcatgagctgctgacttactgtgattca
gattctagtcccatggctttgttcctgaaaatgataggcccaacccatggccagatgaca
gtcacaagacttgtgaatacgttaaaagaaggaaaacgcctgccgtgcccacctaactgt
ccagatgaggtttatcaacttatgaggaaatgctgggaattccaaccatccaatcggaca
agctttcagaaccttattgaaggatttgaagcacttttaaaataa

DBGET integrated database retrieval system