KEGG   Homo sapiens (human): 3717Help
Entry
3717              CDS       T01001                                 

Gene name
JAK2, JTK10, THCYT3
Definition
Janus kinase 2 (EC:2.7.10.2)
Orthology
K04447  
Janus kinase 2 [EC:2.7.10.2]
Organism
hsa  Homo sapiens (human)
Pathway
Chemokine signaling pathway
PI3K-Akt signaling pathway
Jak-STAT signaling pathway
Cholinergic synapse
Prolactin signaling pathway
Adipocytokine signaling pathway
Leishmaniasis
Toxoplasmosis
Tuberculosis
Measles
Influenza A
Herpes simplex infection
Disease
H00012  
Polycythemia vera
Drug target
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    3717 (JAK2)
   04151 PI3K-Akt signaling pathway
    3717 (JAK2)
 Organismal Systems
  Immune system
   04062 Chemokine signaling pathway
    3717 (JAK2)
  Endocrine system
   04920 Adipocytokine signaling pathway
    3717 (JAK2)
   04917 Prolactin signaling pathway
    3717 (JAK2)
  Nervous system
   04725 Cholinergic synapse
    3717 (JAK2)
 Human Diseases
  Infectious diseases
   05152 Tuberculosis
    3717 (JAK2)
   05162 Measles
    3717 (JAK2)
   05164 Influenza A
    3717 (JAK2)
   05168 Herpes simplex infection
    3717 (JAK2)
   05145 Toxoplasmosis
    3717 (JAK2)
   05140 Leishmaniasis
    3717 (JAK2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     3717 (JAK2)
Protein kinases [BR:hsa01001]
 Tyrosine protein kinases
  JAK family [OT]
   3717 (JAK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
9p24
AA seq 1132 aa AA seqDB search
MGMACLTMTEMEGTSTSSIYQNGDISGNANSMKQIDPVLQVYLYHSLGKSEADYLTFPSG
EYVAEEICIAASKACGITPVYHNMFALMSETERIWYPPNHVFHIDESTRHNVLYRIRFYF
PRWYCSGSNRAYRHGISRGAEAPLLDDFVMSYLFAQWRHDFVHGWIKVPVTHETQEECLG
MAVLDMMRIAKENDQTPLAIYNSISYKTFLPKCIRAKIQDYHILTRKRIRYRFRRFIQQF
SQCKATARNLKLKYLINLETLQSAFYTEKFEVKEPGSGPSGEEIFATIIITGNGGIQWSR
GKHKESETLTEQDLQLYCDFPNIIDVSIKQANQEGSNESRVVTIHKQDGKNLEIELSSLR
EALSFVSLIDGYYRLTADAHHYLCKEVAPPAVLENIQSNCHGPISMDFAISKLKKAGNQT
GLYVLRCSPKDFNKYFLTFAVERENVIEYKHCLITKNENEEYNLSGTKKNFSSLKDLLNC
YQMETVRSDNIIFQFTKCCPPKPKDKSNLLVFRTNGVSDVPTSPTLQRPTHMNQMVFHKI
RNEDLIFNESLGQGTFTKIFKGVRREVGDYGQLHETEVLLKVLDKAHRNYSESFFEAASM
MSKLSHKHLVLNYGVCVCGDENILVQEFVKFGSLDTYLKKNKNCINILWKLEVAKQLAWA
MHFLEENTLIHGNVCAKNILLIREEDRKTGNPPFIKLSDPGISITVLPKDILQERIPWVP
PECIENPKNLNLATDKWSFGTTLWEICSGGDKPLSALDSQRKLQFYEDRHQLPAPKWAEL
ANLINNCMDYEPDFRPSFRAIIRDLNSLFTPDYELLTENDMLPNMRIGALGFSGAFEDRD
PTQFEERHLKFLQQLGKGNFGSVEMCRYDPLQDNTGEVVAVKKLQHSTEEHLRDFEREIE
ILKSLQHDNIVKYKGVCYSAGRRNLKLIMEYLPYGSLRDYLQKHKERIDHIKLLQYTSQI
CKGMEYLGTKRYIHRDLATRNILVENENRVKIGDFGLTKVLPQDKEYYKVKEPGESPIFW
YAPESLTESKFSVASDVWSFGVVLYELFTYIEKSKSPPAEFMRMIGNDKQGQMIVFHLIE
LLKNNGRLPRPDGCPDEIYMIMTECWNNNVNQRPSFRDLALRVDQIRDNMAG
NT seq 3399 nt NT seq  +upstreamnt  +downstreamnt
atgggaatggcctgccttacgatgacagaaatggagggaacatccacctcttctatatat
cagaatggtgatatttctggaaatgccaattctatgaagcaaatagatccagttcttcag
gtgtatctttaccattcccttgggaaatctgaggcagattatctgacctttccatctggg
gagtatgttgcagaagaaatctgtattgctgcttctaaagcttgtggtatcacacctgtg
tatcataatatgtttgctttaatgagtgaaacagaaaggatctggtatccacccaaccat
gtcttccatatagatgagtcaaccaggcataatgtactctacagaataagattttacttt
cctcgttggtattgcagtggcagcaacagagcctatcggcatggaatatctcgaggtgct
gaagctcctcttcttgatgactttgtcatgtcttacctctttgctcagtggcggcatgat
tttgtgcacggatggataaaagtacctgtgactcatgaaacacaggaagaatgtcttggg
atggcagtgttagatatgatgagaatagccaaagaaaacgatcaaaccccactggccatc
tataactctatcagctacaagacattcttaccaaaatgtattcgagcaaagatccaagac
tatcatattttgacaaggaagcgaataaggtacagatttcgcagatttattcagcaattc
agccaatgcaaagccactgccagaaacttgaaacttaagtatcttataaatctggaaact
ctgcagtctgccttctacacagagaaatttgaagtaaaagaacctggaagtggtccttca
ggtgaggagatttttgcaaccattataataactggaaacggtggaattcagtggtcaaga
gggaaacataaagaaagtgagacactgacagaacaggatttacagttatattgcgatttt
cctaatattattgatgtcagtattaagcaagcaaaccaagagggttcaaatgaaagccga
gttgtaactatccataagcaagatggtaaaaatctggaaattgaacttagctcattaagg
gaagctttgtctttcgtgtcattaattgatggatattatagattaactgcagatgcacat
cattacctctgtaaagaagtagcacctccagccgtgcttgaaaatatacaaagcaactgt
catggcccaatttcgatggattttgccattagtaaactgaagaaagcaggtaatcagact
ggactgtatgtacttcgatgcagtcctaaggactttaataaatattttttgacttttgct
gtcgagcgagaaaatgtcattgaatataaacactgtttgattacaaaaaatgagaatgaa
gagtacaacctcagtgggacaaagaagaacttcagcagtcttaaagatcttttgaattgt
taccagatggaaactgttcgctcagacaatataattttccagtttactaaatgctgtccc
ccaaagccaaaagataaatcaaaccttctagtcttcagaacgaatggtgtttctgatgta
ccaacctcaccaacattacagaggcctactcatatgaaccaaatggtgtttcacaaaatc
agaaatgaagatttgatatttaatgaaagccttggccaaggcacttttacaaagattttt
aaaggcgtacgaagagaagtaggagactacggtcaactgcatgaaacagaagttctttta
aaagttctggataaagcacacagaaactattcagagtctttctttgaagcagcaagtatg
atgagcaagctttctcacaagcatttggttttaaattatggagtatgtgtctgtggagac
gagaatattctggttcaggagtttgtaaaatttggatcactagatacatatctgaaaaag
aataaaaattgtataaatatattatggaaacttgaagttgctaaacagttggcatgggcc
atgcattttctagaagaaaacacccttattcatgggaatgtatgtgccaaaaatattctg
cttatcagagaagaagacaggaagacaggaaatcctcctttcatcaaacttagtgatcct
ggcattagtattacagttttgccaaaggacattcttcaggagagaataccatgggtacca
cctgaatgcattgaaaatcctaaaaatttaaatttggcaacagacaaatggagttttggt
accactttgtgggaaatctgcagtggaggagataaacctctaagtgctctggattctcaa
agaaagctacaattttatgaagataggcatcagcttcctgcaccaaagtgggcagaatta
gcaaaccttataaataattgtatggattatgaaccagatttcaggccttctttcagagcc
atcatacgagatcttaacagtttgtttactccagattatgaactattaacagaaaatgac
atgttaccaaatatgaggataggtgccctggggttttctggtgcctttgaagaccgggat
cctacacagtttgaagagagacatttgaaatttctacagcaacttggcaagggtaatttt
gggagtgtggagatgtgccggtatgaccctctacaggacaacactggggaggtggtcgct
gtaaaaaagcttcagcatagtactgaagagcacctaagagactttgaaagggaaattgaa
atcctgaaatccctacagcatgacaacattgtaaagtacaagggagtgtgctacagtgct
ggtcggcgtaatctaaaattaattatggaatatttaccatatggaagtttacgagactat
cttcaaaaacataaagaacggatagatcacataaaacttctgcagtacacatctcagata
tgcaagggtatggagtatcttggtacaaaaaggtatatccacagggatctggcaacgaga
aatatattggtggagaacgagaacagagttaaaattggagattttgggttaaccaaagtc
ttgccacaagacaaagaatactataaagtaaaagaacctggtgaaagtcccatattctgg
tatgctccagaatcactgacagagagcaagttttctgtggcctcagatgtttggagcttt
ggagtggttctgtatgaacttttcacatacattgagaagagtaaaagtccaccagcggaa
tttatgcgtatgattggcaatgacaaacaaggacagatgatcgtgttccatttgatagaa
cttttgaagaataatggaagattaccaagaccagatggatgcccagatgagatctatatg
atcatgacagaatgctggaacaataatgtaaatcaacgcccctcctttagggatctagct
cttcgagtggatcaaataagggataacatggctggatga

DBGET integrated database retrieval system