KEGG   Homo sapiens (human): 3718Help
Entry
3718              CDS       T01001                                 

Gene name
JAK3, JAK-3, JAK3_HUMAN, JAKL, L-JAK, LJAK
Definition
(RefSeq) Janus kinase 3
  KO
K11218  Janus kinase 3 [EC:2.7.10.2]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04062  Chemokine signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04217  Necroptosis
hsa04550  Signaling pathways regulating pluripotency of stem cells
hsa04630  Jak-STAT signaling pathway
hsa04658  Th1 and Th2 cell differentiation
hsa04659  Th17 cell differentiation
hsa05162  Measles
hsa05166  HTLV-I infection
hsa05169  Epstein-Barr virus infection
hsa05200  Pathways in cancer
hsa05203  Viral carcinogenesis
hsa05223  Non-small cell lung cancer
hsa05340  Primary immunodeficiency
Module
hsa_M00684  JAK-STAT signaling
Network
N00053  Cytokine-Jak-STAT signaling pathway
N00105  EML4-ALK fusion kinase to Jak-STAT signaling pathway
N00265  EBV LMP1 to host-cell-protein activation
Disease
H00091  T-B+Severe combined immunodeficiencies (SCIDs)
Drug target
Decernotinib: D10585
Delgocitinib: D11046
Peficitinib (DG01853): D10653 D10721
Tofacitinib (DG00742): D09783 D09970
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    3718 (JAK3)
   04151 PI3K-Akt signaling pathway
    3718 (JAK3)
 Cellular Processes
  Cell growth and death
   04217 Necroptosis
    3718 (JAK3)
  Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    3718 (JAK3)
 Organismal Systems
  Immune system
   04658 Th1 and Th2 cell differentiation
    3718 (JAK3)
   04659 Th17 cell differentiation
    3718 (JAK3)
   04062 Chemokine signaling pathway
    3718 (JAK3)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    3718 (JAK3)
   05203 Viral carcinogenesis
    3718 (JAK3)
   05223 Non-small cell lung cancer
    3718 (JAK3)
  Immune diseases
   05340 Primary immunodeficiency
    3718 (JAK3)
  Infectious diseases
   05166 HTLV-I infection
    3718 (JAK3)
   05162 Measles
    3718 (JAK3)
   05169 Epstein-Barr virus infection
    3718 (JAK3)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     3718 (JAK3)
Protein kinases [BR:hsa01001]
 Non-receptor tyrosine kinases
  JAK family [OT]
   3718 (JAK3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase Kdo APH SH2 Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 3718
NCBI-ProteinID: NP_000206
OMIM: 600173
HGNC: 6193
Ensembl: ENSG00000105639
Vega: OTTHUMG00000165648
Pharos: P52333(Tclin)
UniProt: P52333 A0A024R7M7
Structure
PDB: 

Jmol
Position
19p13.11
AA seq 1124 aa AA seqDB search
MAPPSEETPLIPQRSCSLLSTEAGALHVLLPARGPGPPQRLSFSFGDHLAEDLCVQAAKA
SGILPVYHSLFALATEDLSCWFPPSHIFSVEDASTQVLLYRIRFYFPNWFGLEKCHRFGL
RKDLASAILDLPVLEHLFAQHRSDLVSGRLPVGLSLKEQGECLSLAVLDLARMAREQAQR
PGELLKTVSYKACLPPSLRDLIQGLSFVTRRRIRRTVRRALRRVAACQADRHSLMAKYIM
DLERLDPAGAAETFHVGLPGALGGHDGLGLLRVAGDGGIAWTQGEQEVLQPFCDFPEIVD
ISIKQAPRVGPAGEHRLVTVTRTDNQILEAEFPGLPEALSFVALVDGYFRLTTDSQHFFC
KEVAPPRLLEEVAEQCHGPITLDFAINKLKTGGSRPGSYVLRRSPQDFDSFLLTVCVQNP
LGPDYKGCLIRRSPTGTFLLVGLSRPHSSLRELLATCWDGGLHVDGVAVTLTSCCIPRPK
EKSNLIVVQRGHSPPTSSLVQPQSQYQLSQMTFHKIPADSLEWHENLGHGSFTKIYRGCR
HEVVDGEARKTEVLLKVMDAKHKNCMESFLEAASLMSQVSYRHLVLLHGVCMAGDSTMVQ
EFVHLGAIDMYLRKRGHLVPASWKLQVVKQLAYALNYLEDKGLPHGNVSARKVLLAREGA
DGSPPFIKLSDPGVSPAVLSLEMLTDRIPWVAPECLREAQTLSLEADKWGFGATVWEVFS
GVTMPISALDPAKKLQFYEDRQQLPAPKWTELALLIQQCMAYEPVQRPSFRAVIRDLNSL
ISSDYELLSDPTPGALAPRDGLWNGAQLYACQDPTIFEERHLKYISQLGKGNFGSVELCR
YDPLGDNTGALVAVKQLQHSGPDQQRDFQREIQILKALHSDFIVKYRGVSYGPGRQSLRL
VMEYLPSGCLRDFLQRHRARLDASRLLLYSSQICKGMEYLGSRRCVHRDLAARNILVESE
AHVKIADFGLAKLLPLDKDYYVVREPGQSPIFWYAPESLSDNIFSRQSDVWSFGVVLYEL
FTYCDKSCSPSAEFLRMMGCERDVPALCRLLELLEEGQRLPAPPACPAEVHELMKLCWAP
SPQDRPSFSALGPQLDMLWSGSRGCETHAFTAHPEGKHHSLSFS
NT seq 3375 nt NT seq  +upstreamnt  +downstreamnt
atggcacctccaagtgaagagacgcccctgatccctcagcgttcatgcagcctcttgtcc
acggaggctggtgccctgcatgtgctgctgcccgctcggggccccgggcccccccagcgc
ctatctttctcctttggggaccacttggctgaggacctgtgcgtgcaggctgccaaggcc
agcggcatcctgcctgtgtaccactccctctttgctctggccacggaggacctgtcctgc
tggttccccccgagccacatcttctccgtggaggatgccagcacccaagtcctgctgtac
aggattcgcttttacttccccaattggtttgggctggagaagtgccaccgcttcgggcta
cgcaaggatttggccagtgctatccttgacctgccagtcctggagcacctctttgcccag
caccgcagtgacctggtgagtgggcgcctccccgtgggcctcagtctcaaggagcagggt
gagtgtctcagcctggccgtgttggacctggcccggatggcgcgagagcaggcccagcgg
ccgggagagctgctgaagactgtcagctacaaggcctgcctacccccaagcctgcgcgac
ctgatccagggcctgagcttcgtgacgcggaggcgtattcggaggacggtgcgcagagcc
ctgcgccgcgtggccgcctgccaggcagaccggcactcgctcatggccaagtacatcatg
gacctggagcggctggatccagccggggccgccgagaccttccacgtgggcctccctggg
gcccttggtggccacgacgggctggggctgctccgcgtggctggtgacggcggcatcgcc
tggacccagggagaacaggaggtcctccagcccttctgcgactttccagaaatcgtagac
attagcatcaagcaggccccgcgcgttggcccggccggagagcaccgcctggtcactgtt
accaggacagacaaccagattttagaggccgagttcccagggctgcccgaggctctgtcg
ttcgtggcgctcgtggacggctacttccggctgaccacggactcccagcacttcttctgc
aaggaggtggcaccgccgaggctgctggaggaagtggccgagcagtgccacggccccatc
actctggactttgccatcaacaagctcaagactgggggctcacgtcctggctcctatgtt
ctccgccgcagcccccaggactttgacagcttcctcctcactgtctgtgtccagaacccc
cttggtcctgattataagggctgcctcatccggcgcagccccacaggaaccttccttctg
gttggcctcagccgaccccacagcagtcttcgagagctcctggcaacctgctgggatggg
gggctgcacgtagatggggtggcagtgaccctcacttcctgctgtatccccagacccaaa
gaaaagtccaacctgatcgtggtccagagaggtcacagcccacccacatcatccttggtt
cagccccaatcccaataccagctgagtcagatgacatttcacaagatccctgctgacagc
ctggagtggcatgagaacctgggccatgggtccttcaccaagatttaccggggctgtcgc
catgaggtggtggatggggaggcccgaaagacagaggtgctgctgaaggtcatggatgcc
aagcacaagaactgcatggagtcattcctggaagcagcgagcttgatgagccaagtgtcg
taccggcatctcgtgctgctccacggcgtgtgcatggctggagacagcaccatggtgcag
gaatttgtacacctgggggccatagacatgtatctgcgaaaacgtggccacctggtgcca
gccagctggaagctgcaggtggtcaaacagctggcctacgccctcaactatctggaggac
aaaggcctgccccatggcaatgtctctgcccggaaggtgctcctggctcgggagggggct
gatgggagcccgcccttcatcaagctgagtgaccctggggtcagccccgctgtgttaagc
ctggagatgctcaccgacaggatcccctgggtggcccccgagtgtctccgggaggcgcag
acacttagcttggaagctgacaagtggggcttcggcgccacggtctgggaagtgtttagt
ggcgtcaccatgcccatcagtgccctggatcctgctaagaaactccaattttatgaggac
cggcagcagctgccggcccccaagtggacagagctggccctgctgattcaacagtgcatg
gcctatgagccggtccagaggccctccttccgagccgtcattcgtgacctcaatagcctc
atctcttcagactatgagctcctctcagaccccacacctggtgccctggcacctcgtgat
gggctgtggaatggtgcccagctctatgcctgccaagaccccacgatcttcgaggagaga
cacctcaagtacatctcacagctgggcaagggcaactttggcagcgtggagctgtgccgc
tatgacccgctaggcgacaatacaggtgccctggtggccgtgaaacagctgcagcacagc
gggccagaccagcagagggactttcagcgggagattcagatcctcaaagcactgcacagt
gatttcattgtcaagtatcgtggtgtcagctatggcccgggccgccagagcctgcggctg
gtcatggagtacctgcccagcggctgcttgcgcgacttcctgcagcggcaccgcgcgcgc
ctcgatgccagccgcctccttctctattcctcgcagatctgcaagggcatggagtacctg
ggctcccgccgctgcgtgcaccgcgacctggccgcccgaaacatcctcgtggagagcgag
gcacacgtcaagatcgctgacttcggcctagctaagctgctgccgcttgacaaagactac
tacgtggtccgcgagccaggccagagccccattttctggtatgcccccgaatccctctcg
gacaacatcttctctcgccagtcagacgtctggagcttcggggtcgtcctgtacgagctc
ttcacctactgcgacaaaagctgcagcccctcggccgagttcctgcggatgatgggatgt
gagcgggatgtccccgccctctgccgcctcttggaactgctggaggagggccagaggctg
ccggcgcctcctgcctgccctgctgaggttcacgagctcatgaagctgtgctgggcccct
agcccacaggaccggccatcattcagcgccctgggcccccagctggacatgctgtggagc
ggaagccgggggtgtgagactcatgccttcactgctcacccagagggcaaacaccactcc
ctgtccttttcatag

DBGET integrated database retrieval system