KEGG   Homo sapiens (human): 3718Help
Entry
3718              CDS       T01001                                 

Gene name
JAK3, JAK-3, JAK3_HUMAN, JAKL, L-JAK, LJAK
Definition
Janus kinase 3 (EC:2.7.10.2)
Orthology
K11218  
Janus kinase 3 [EC:2.7.10.2]
Organism
hsa  Homo sapiens (human)
Pathway
Chemokine signaling pathway
PI3K-Akt signaling pathway
Signaling pathways regulating pluripotency of stem cells
Jak-STAT signaling pathway
Measles
HTLV-I infection
Epstein-Barr virus infection
Viral carcinogenesis
Primary immunodeficiency
Module
JAK-STAT signaling
Disease
H00091  
T-B+Severe combined immunodeficiencies (SCIDs)
Drug target
Tofacitinib: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    3718 (JAK3)
   04151 PI3K-Akt signaling pathway
    3718 (JAK3)
 Cellular Processes
  Cellular commiunity
   04550 Signaling pathways regulating pluripotency of stem cells
    3718 (JAK3)
 Organismal Systems
  Immune system
   04062 Chemokine signaling pathway
    3718 (JAK3)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    3718 (JAK3)
  Immune diseases
   05340 Primary immunodeficiency
    3718 (JAK3)
  Infectious diseases
   05166 HTLV-I infection
    3718 (JAK3)
   05162 Measles
    3718 (JAK3)
   05169 Epstein-Barr virus infection
    3718 (JAK3)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     3718 (JAK3)
Protein kinases [BR:hsa01001]
 Tyrosine protein kinases
  JAK family [OT]
   3718 (JAK3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
UniProt: 
Structure
PDB: 

Jmol
Position
19p13.1
AA seq 1124 aa AA seqDB search
MAPPSEETPLIPQRSCSLLSTEAGALHVLLPARGPGPPQRLSFSFGDHLAEDLCVQAAKA
SGILPVYHSLFALATEDLSCWFPPSHIFSVEDASTQVLLYRIRFYFPNWFGLEKCHRFGL
RKDLASAILDLPVLEHLFAQHRSDLVSGRLPVGLSLKEQGECLSLAVLDLARMAREQAQR
PGELLKTVSYKACLPPSLRDLIQGLSFVTRRRIRRTVRRALRRVAACQADRHSLMAKYIM
DLERLDPAGAAETFHVGLPGALGGHDGLGLLRVAGDGGIAWTQGEQEVLQPFCDFPEIVD
ISIKQAPRVGPAGEHRLVTVTRTDNQILEAEFPGLPEALSFVALVDGYFRLTTDSQHFFC
KEVAPPRLLEEVAEQCHGPITLDFAINKLKTGGSRPGSYVLRRSPQDFDSFLLTVCVQNP
LGPDYKGCLIRRSPTGTFLLVGLSRPHSSLRELLATCWDGGLHVDGVAVTLTSCCIPRPK
EKSNLIVVQRGHSPPTSSLVQPQSQYQLSQMTFHKIPADSLEWHENLGHGSFTKIYRGCR
HEVVDGEARKTEVLLKVMDAKHKNCMESFLEAASLMSQVSYRHLVLLHGVCMAGDSTMVQ
EFVHLGAIDMYLRKRGHLVPASWKLQVVKQLAYALNYLEDKGLPHGNVSARKVLLAREGA
DGSPPFIKLSDPGVSPAVLSLEMLTDRIPWVAPECLREAQTLSLEADKWGFGATVWEVFS
GVTMPISALDPAKKLQFYEDRQQLPAPKWTELALLIQQCMAYEPVQRPSFRAVIRDLNSL
ISSDYELLSDPTPGALAPRDGLWNGAQLYACQDPTIFEERHLKYISQLGKGNFGSVELCR
YDPLGDNTGALVAVKQLQHSGPDQQRDFQREIQILKALHSDFIVKYRGVSYGPGRQSLRL
VMEYLPSGCLRDFLQRHRARLDASRLLLYSSQICKGMEYLGSRRCVHRDLAARNILVESE
AHVKIADFGLAKLLPLDKDYYVVREPGQSPIFWYAPESLSDNIFSRQSDVWSFGVVLYEL
FTYCDKSCSPSAEFLRMMGCERDVPALCRLLELLEEGQRLPAPPACPAEVHELMKLCWAP
SPQDRPSFSALGPQLDMLWSGSRGCETHAFTAHPEGKHHSLSFS
NT seq 3375 nt NT seq  +upstreamnt  +downstreamnt
atggcacctccaagtgaagagacgcccctgatccctcagcgttcatgcagcctcttgtcc
acggaggctggtgccctgcatgtgctgctgcccgctcggggccccgggcccccccagcgc
ctatctttctcctttggggaccacttggctgaggacctgtgcgtgcaggctgccaaggcc
agcggcatcctgcctgtgtaccactccctctttgctctggccacggaggacctgtcctgc
tggttccccccgagccacatcttctccgtggaggatgccagcacccaagtcctgctgtac
aggattcgcttttacttccccaattggtttgggctggagaagtgccaccgcttcgggcta
cgcaaggatttggccagtgctatccttgacctgccagtcctggagcacctctttgcccag
caccgcagtgacctggtgagtgggcgcctccccgtgggcctcagtctcaaggagcagggt
gagtgtctcagcctggccgtgttggacctggcccggatggcgcgagagcaggcccagcgg
ccgggagagctgctgaagactgtcagctacaaggcctgcctacccccaagcctgcgcgac
ctgatccagggcctgagcttcgtgacgcggaggcgtattcggaggacggtgcgcagagcc
ctgcgccgcgtggccgcctgccaggcagaccggcactcgctcatggccaagtacatcatg
gacctggagcggctggatccagccggggccgccgagaccttccacgtgggcctccctggg
gcccttggtggccacgacgggctggggctgctccgcgtggctggtgacggcggcatcgcc
tggacccagggagaacaggaggtcctccagcccttctgcgactttccagaaatcgtagac
attagcatcaagcaggccccgcgcgttggcccggccggagagcaccgcctggtcactgtt
accaggacagacaaccagattttagaggccgagttcccagggctgcccgaggctctgtcg
ttcgtggcgctcgtggacggctacttccggctgaccacggactcccagcacttcttctgc
aaggaggtggcaccgccgaggctgctggaggaagtggccgagcagtgccacggccccatc
actctggactttgccatcaacaagctcaagactgggggctcacgtcctggctcctatgtt
ctccgccgcagcccccaggactttgacagcttcctcctcactgtctgtgtccagaacccc
cttggtcctgattataagggctgcctcatccggcgcagccccacaggaaccttccttctg
gttggcctcagccgaccccacagcagtcttcgagagctcctggcaacctgctgggatggg
gggctgcacgtagatggggtggcagtgaccctcacttcctgctgtatccccagacccaaa
gaaaagtccaacctgatcgtggtccagagaggtcacagcccacccacatcatccttggtt
cagccccaatcccaataccagctgagtcagatgacatttcacaagatccctgctgacagc
ctggagtggcatgagaacctgggccatgggtccttcaccaagatttaccggggctgtcgc
catgaggtggtggatggggaggcccgaaagacagaggtgctgctgaaggtcatggatgcc
aagcacaagaactgcatggagtcattcctggaagcagcgagcttgatgagccaagtgtcg
taccggcatctcgtgctgctccacggcgtgtgcatggctggagacagcaccatggtgcag
gaatttgtacacctgggggccatagacatgtatctgcgaaaacgtggccacctggtgcca
gccagctggaagctgcaggtggtcaaacagctggcctacgccctcaactatctggaggac
aaaggcctgccccatggcaatgtctctgcccggaaggtgctcctggctcgggagggggct
gatgggagcccgcccttcatcaagctgagtgaccctggggtcagccccgctgtgttaagc
ctggagatgctcaccgacaggatcccctgggtggcccccgagtgtctccgggaggcgcag
acacttagcttggaagctgacaagtggggcttcggcgccacggtctgggaagtgtttagt
ggcgtcaccatgcccatcagtgccctggatcctgctaagaaactccaattttatgaggac
cggcagcagctgccggcccccaagtggacagagctggccctgctgattcaacagtgcatg
gcctatgagccggtccagaggccctccttccgagccgtcattcgtgacctcaatagcctc
atctcttcagactatgagctcctctcagaccccacacctggtgccctggcacctcgtgat
gggctgtggaatggtgcccagctctatgcctgccaagaccccacgatcttcgaggagaga
cacctcaagtacatctcacagctgggcaagggcaactttggcagcgtggagctgtgccgc
tatgacccgctaggcgacaatacaggtgccctggtggccgtgaaacagctgcagcacagc
gggccagaccagcagagggactttcagcgggagattcagatcctcaaagcactgcacagt
gatttcattgtcaagtatcgtggtgtcagctatggcccgggccgccagagcctgcggctg
gtcatggagtacctgcccagcggctgcttgcgcgacttcctgcagcggcaccgcgcgcgc
ctcgatgccagccgcctccttctctattcctcgcagatctgcaagggcatggagtacctg
ggctcccgccgctgcgtgcaccgcgacctggccgcccgaaacatcctcgtggagagcgag
gcacacgtcaagatcgctgacttcggcctagctaagctgctgccgcttgacaaagactac
tacgtggtccgcgagccaggccagagccccattttctggtatgcccccgaatccctctcg
gacaacatcttctctcgccagtcagacgtctggagcttcggggtcgtcctgtacgagctc
ttcacctactgcgacaaaagctgcagcccctcggccgagttcctgcggatgatgggatgt
gagcgggatgtccccgccctctgccgcctcttggaactgctggaggagggccagaggctg
ccggcgcctcctgcctgccctgctgaggttcacgagctcatgaagctgtgctgggcccct
agcccacaggaccggccatcattcagcgccctgggcccccagctggacatgctgtggagc
ggaagccgggggtgtgagactcatgccttcactgctcacccagagggcaaacaccactcc
ctgtccttttcatag

DBGET integrated database retrieval system