KEGG   Homo sapiens (human): 3725Help
Entry
3725              CDS       T01001                                 

Gene name
JUN, AP-1, AP1, c-Jun
Definition
jun proto-oncogene
Orthology
K04448  
transcription factor AP-1
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
ErbB signaling pathway
Wnt signaling pathway
Osteoclast differentiation
Focal adhesion
Toll-like receptor signaling pathway
T cell receptor signaling pathway
B cell receptor signaling pathway
TNF signaling pathway
Neurotrophin signaling pathway
GnRH signaling pathway
Estrogen signaling pathway
Oxytocin signaling pathway
Non-alcoholic fatty liver disease (NAFLD)
Cocaine addiction
Amphetamine addiction
Epithelial cell signaling in Helicobacter pylori infection
Salmonella infection
Pertussis
Leishmaniasis
Chagas disease (American trypanosomiasis)
Hepatitis B
Influenza A
HTLV-I infection
Herpes simplex infection
Epstein-Barr virus infection
Pathways in cancer
Viral carcinogenesis
Colorectal cancer
Renal cell carcinoma
Inflammatory bowel disease (IBD)
Rheumatoid arthritis
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:hsa04010]
Environmental Information Processing; Signal transduction; ErbB signaling pathway [PATH:hsa04012]
Environmental Information Processing; Signal transduction; Wnt signaling pathway [PATH:hsa04310]
Environmental Information Processing; Signal transduction; TNF signaling pathway [PATH:hsa04668]
Cellular Processes; Cell communication; Focal adhesion [PATH:hsa04510]
Organismal Systems; Immune system; Toll-like receptor signaling pathway [PATH:hsa04620]
Organismal Systems; Immune system; T cell receptor signaling pathway [PATH:hsa04660]
Organismal Systems; Immune system; B cell receptor signaling pathway [PATH:hsa04662]
Organismal Systems; Endocrine system; GnRH signaling pathway [PATH:hsa04912]
Organismal Systems; Endocrine system; Estrogen signaling pathway [PATH:hsa04915]
Organismal Systems; Endocrine system; Oxytocin signaling pathway [PATH:hsa04921]
Organismal Systems; Nervous system; Neurotrophin signaling pathway [PATH:hsa04722]
Organismal Systems; Development; Osteoclast differentiation [PATH:hsa04380]
Human Diseases; Cancers; Pathways in cancer [PATH:hsa05200]
Human Diseases; Cancers; Viral carcinogenesis [PATH:hsa05203]
Human Diseases; Cancers; Colorectal cancer [PATH:hsa05210]
Human Diseases; Cancers; Renal cell carcinoma [PATH:hsa05211]
Human Diseases; Immune diseases; Rheumatoid arthritis [PATH:hsa05323]
Human Diseases; Immune diseases; Inflammatiory bowel disease (IBD) [PATH:hsa05321]
Human Diseases; Substance dependence; Cocaine addiction [PATH:hsa05030]
Human Diseases; Substance dependence; Amphetamine addiction [PATH:hsa05031]
Human Diseases; Endocrine and metabolic diseases; Non-alcoholic fatty liver disease (NAFLD) [PATH:hsa04932]
Human Diseases; Infectious diseases; Epithelial cell signaling in Helicobacter pylori infection [PATH:hsa05120]
Human Diseases; Infectious diseases; Salmonella infection [PATH:hsa05132]
Human Diseases; Infectious diseases; Pertussis [PATH:hsa05133]
Human Diseases; Infectious diseases; HTLV-I infection [PATH:hsa05166]
Human Diseases; Infectious diseases; Influenza A [PATH:hsa05164]
Human Diseases; Infectious diseases; Hepatitis B [PATH:hsa05161]
Human Diseases; Infectious diseases; Herpes simplex infection [PATH:hsa05168]
Human Diseases; Infectious diseases; Epstein-Barr virus infection [PATH:hsa05169]
Human Diseases; Infectious diseases; Leishmaniasis [PATH:hsa05140]
Human Diseases; Infectious diseases; Chagas disease (American trypanosomiasis) [PATH:hsa05142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1p32-p31
AA seq 331 aa AA seqDB search
MTAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDL
LTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAE
LHSQNTLPSVTSAAQPVNGAGMVAPAVASVAGGSGSGGFSASLHSEPPVYANLSNFNPGA
LSSGGGAPSYGAAGLAFPAQPQQQQQPPHHLPQQMPVQHPRLQALKEEPQTVPEMPGETP
PLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELASTANM
LREQVAQLKQKVMNHVNSGCQLMLTQQLQTF
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgactgcaaagatggaaacgaccttctatgacgatgccctcaacgcctcgttcctcccg
tccgagagcggaccttatggctacagtaaccccaagatcctgaaacagagcatgaccctg
aacctggccgacccagtggggagcctgaagccgcacctccgcgccaagaactcggacctc
ctcacctcgcccgacgtggggctgctcaagctggcgtcgcccgagctggagcgcctgata
atccagtccagcaacgggcacatcaccaccacgccgacccccacccagttcctgtgcccc
aagaacgtgacagatgagcaggagggcttcgccgagggcttcgtgcgcgccctggccgaa
ctgcacagccagaacacgctgcccagcgtcacgtcggcggcgcagccggtcaacggggca
ggcatggtggctcccgcggtagcctcggtggcagggggcagcggcagcggcggcttcagc
gccagcctgcacagcgagccgccggtctacgcaaacctcagcaacttcaacccaggcgcg
ctgagcagcggcggcggggcgccctcctacggcgcggccggcctggcctttcccgcgcaa
ccccagcagcagcagcagccgccgcaccacctgccccagcagatgcccgtgcagcacccg
cggctgcaggccctgaaggaggagcctcagacagtgcccgagatgcccggcgagacaccg
cccctgtcccccatcgacatggagtcccaggagcggatcaaggcggagaggaagcgcatg
aggaaccgcatcgctgcctccaagtgccgaaaaaggaagctggagagaatcgcccggctg
gaggaaaaagtgaaaaccttgaaagctcagaactcggagctggcgtccacggccaacatg
ctcagggaacaggtggcacagcttaaacagaaagtcatgaaccacgttaacagtgggtgc
caactcatgctaacgcagcagttgcaaacattttga

DBGET integrated database retrieval system