KEGG   Homo sapiens (human): 3725Help
Entry
3725              CDS       T01001                                 

Gene name
JUN, AP-1, AP1, c-Jun
Definition
jun proto-oncogene
Orthology
K04448  
transcription factor AP-1
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
ErbB signaling pathway
cAMP signaling pathway
Wnt signaling pathway
Osteoclast differentiation
Focal adhesion
Toll-like receptor signaling pathway
T cell receptor signaling pathway
B cell receptor signaling pathway
TNF signaling pathway
Neurotrophin signaling pathway
GnRH signaling pathway
Estrogen signaling pathway
Oxytocin signaling pathway
Non-alcoholic fatty liver disease (NAFLD)
Cocaine addiction
Amphetamine addiction
Epithelial cell signaling in Helicobacter pylori infection
Salmonella infection
Pertussis
Leishmaniasis
Chagas disease (American trypanosomiasis)
Hepatitis B
Influenza A
HTLV-I infection
Herpes simplex infection
Epstein-Barr virus infection
Pathways in cancer
Viral carcinogenesis
Colorectal cancer
Renal cell carcinoma
Choline metabolism in cancer
Inflammatory bowel disease (IBD)
Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    3725 (JUN)
   04012 ErbB signaling pathway
    3725 (JUN)
   04310 Wnt signaling pathway
    3725 (JUN)
   04668 TNF signaling pathway
    3725 (JUN)
   04024 cAMP signaling pathway
    3725 (JUN)
 Cellular Processes
  Cellular commiunity
   04510 Focal adhesion
    3725 (JUN)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    3725 (JUN)
   04660 T cell receptor signaling pathway
    3725 (JUN)
   04662 B cell receptor signaling pathway
    3725 (JUN)
  Endocrine system
   04912 GnRH signaling pathway
    3725 (JUN)
   04915 Estrogen signaling pathway
    3725 (JUN)
   04921 Oxytocin signaling pathway
    3725 (JUN)
  Nervous system
   04722 Neurotrophin signaling pathway
    3725 (JUN)
  Development
   04380 Osteoclast differentiation
    3725 (JUN)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    3725 (JUN)
   05231 Choline metabolism in cancer
    3725 (JUN)
   05203 Viral carcinogenesis
    3725 (JUN)
   05210 Colorectal cancer
    3725 (JUN)
   05211 Renal cell carcinoma
    3725 (JUN)
  Immune diseases
   05323 Rheumatoid arthritis
    3725 (JUN)
   05321 Inflammatiory bowel disease (IBD)
    3725 (JUN)
  Substance dependence
   05030 Cocaine addiction
    3725 (JUN)
   05031 Amphetamine addiction
    3725 (JUN)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    3725 (JUN)
  Infectious diseases
   05120 Epithelial cell signaling in Helicobacter pylori infection
    3725 (JUN)
   05132 Salmonella infection
    3725 (JUN)
   05133 Pertussis
    3725 (JUN)
   05166 HTLV-I infection
    3725 (JUN)
   05164 Influenza A
    3725 (JUN)
   05161 Hepatitis B
    3725 (JUN)
   05168 Herpes simplex infection
    3725 (JUN)
   05169 Epstein-Barr virus infection
    3725 (JUN)
   05140 Leishmaniasis
    3725 (JUN)
   05142 Chagas disease (American trypanosomiasis)
    3725 (JUN)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Jun
    3725 (JUN)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1p32-p31
AA seq 331 aa AA seqDB search
MTAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDL
LTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAE
LHSQNTLPSVTSAAQPVNGAGMVAPAVASVAGGSGSGGFSASLHSEPPVYANLSNFNPGA
LSSGGGAPSYGAAGLAFPAQPQQQQQPPHHLPQQMPVQHPRLQALKEEPQTVPEMPGETP
PLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELASTANM
LREQVAQLKQKVMNHVNSGCQLMLTQQLQTF
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgactgcaaagatggaaacgaccttctatgacgatgccctcaacgcctcgttcctcccg
tccgagagcggaccttatggctacagtaaccccaagatcctgaaacagagcatgaccctg
aacctggccgacccagtggggagcctgaagccgcacctccgcgccaagaactcggacctc
ctcacctcgcccgacgtggggctgctcaagctggcgtcgcccgagctggagcgcctgata
atccagtccagcaacgggcacatcaccaccacgccgacccccacccagttcctgtgcccc
aagaacgtgacagatgagcaggagggcttcgccgagggcttcgtgcgcgccctggccgaa
ctgcacagccagaacacgctgcccagcgtcacgtcggcggcgcagccggtcaacggggca
ggcatggtggctcccgcggtagcctcggtggcagggggcagcggcagcggcggcttcagc
gccagcctgcacagcgagccgccggtctacgcaaacctcagcaacttcaacccaggcgcg
ctgagcagcggcggcggggcgccctcctacggcgcggccggcctggcctttcccgcgcaa
ccccagcagcagcagcagccgccgcaccacctgccccagcagatgcccgtgcagcacccg
cggctgcaggccctgaaggaggagcctcagacagtgcccgagatgcccggcgagacaccg
cccctgtcccccatcgacatggagtcccaggagcggatcaaggcggagaggaagcgcatg
aggaaccgcatcgctgcctccaagtgccgaaaaaggaagctggagagaatcgcccggctg
gaggaaaaagtgaaaaccttgaaagctcagaactcggagctggcgtccacggccaacatg
ctcagggaacaggtggcacagcttaaacagaaagtcatgaaccacgttaacagtgggtgc
caactcatgctaacgcagcagttgcaaacattttga

DBGET integrated database retrieval system