KEGG   Homo sapiens (human): 3741Help
Entry
3741              CDS       T01001                                 

Gene name
KCNA5, ATFB7, HCK1, HK2, HPCN1, KV1.5, PCN1
Definition
potassium voltage-gated channel, shaker-related subfamily, member 5
Orthology
K04878  
potassium voltage-gated channel Shaker-related subfamily A member 5
Organism
hsa  Homo sapiens (human)
Disease
H00731  
Atrial fibrillation
Drug target
Bepridil: 
Other: 
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
12p13
AA seq 613 aa AA seqDB search
MEIALVPLENGGAMTVRGGDEARAGCGQATGGELQCPPTAGLSDGPKEPAPKGRGAQRDA
DSGVRPLPPLPDPGVRPLPPLPEELPRPRRPPPEDEEEEGDPGLGTVEDQALGTASLHHQ
RVHINISGLRFETQLGTLAQFPNTLLGDPAKRLRYFDPLRNEYFFDRNRPSFDGILYYYQ
SGGRLRRPVNVSLDVFADEIRFYQLGDEAMERFREDEGFIKEEEKPLPRNEFQRQVWLIF
EYPESSGSARAIAIVSVLVILISIITFCLETLPEFRDERELLRHPPAPHQPPAPAPGANG
SGVMAPPSGPTVAPLLPRTLADPFFIVETTCVIWFTFELLVRFFACPSKAGFSRNIMNII
DVVAIFPYFITLGTELAEQQPGGGGGGQNGQQAMSLAILRVIRLVRVFRIFKLSRHSKGL
QILGKTLQASMRELGLLIFFLFIGVILFSSAVYFAEADNQGTHFSSIPDAFWWAVVTMTT
VGYGDMRPITVGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETDHEEPAVLKEEQG
TQSQGPGLDRGVQRKVSGSRGSFCKAGGTLENADSARRGSCPLEKCNVKAKSNVDLRRSL
YALCLDTSRETDL
NT seq 1842 nt NT seq  +upstreamnt  +downstreamnt
atggagatcgccctggtgcccctggagaacggcggtgccatgaccgtcagaggaggcgat
gaggcccgggcaggctgcggccaggccacagggggagagctccagtgtcccccgacggct
gggctcagcgatgggcccaaggagccggcgccaaaggggcgcggcgcgcagagagacgcg
gactcgggagtgcggcccttgcctccgctgccggacccgggagtgcggcccttgcctccg
ctgccagaggagctgccacggcctcgacggccgcctcccgaggacgaggaggaagaaggc
gatcccggcctgggcacggtggaggaccaggctctgggcacggcgtccctgcaccaccag
cgcgtccacatcaacatctccgggctgcgctttgagacgcagctgggcaccctggcgcag
ttccccaacacactcctgggggaccccgccaagcgcctgcgctacttcgaccccctgagg
aacgagtacttcttcgaccgcaaccggcccagcttcgacggtatcctctactactaccag
tccgggggccgcctgcggaggccggtcaacgtctccctggacgtgttcgcggacgagata
cgcttctaccagctgggggacgaggccatggagcgcttccgcgaggatgagggcttcatt
aaagaagaggagaagcccctgccccgcaacgagttccagcgccaggtgtggcttatcttc
gagtatccggagagctctgggtccgcgcgggccatcgccatcgtctcggtcttggttatc
ctcatctccatcatcaccttctgcttggagaccctgcctgagttcagggatgaacgtgag
ctgctccgccaccctccggcgccccaccagcctcccgcgcccgcccctggggccaacggc
agcggggtcatggccccgccctctggccctacggtggcaccgctcctgcccaggaccctg
gccgaccccttcttcatcgtggagaccacgtgcgtcatctggttcaccttcgagctgctc
gtgcgcttcttcgcctgccccagcaaggcagggttctcccggaacatcatgaacatcatc
gatgtggtggccatcttcccctacttcatcaccctgggcaccgaactggcagagcagcag
ccagggggtggaggaggcggccagaatgggcagcaggccatgtccctggccatcctccga
gtcatccgcctggtccgggtgttccgcatcttcaagctctcccgccactccaaggggctg
cagatcctgggcaagaccttgcaggcctccatgagggagctggggctgctcatcttcttc
ctcttcatcggggtcatcctcttctccagtgccgtctacttcgcagaggctgacaaccag
ggaacccatttctctagcatccctgacgccttctggtgggcagtggtcaccatgaccact
gtgggctacggggacatgaggcccatcactgttgggggcaagatcgtgggctcgctgtgt
gccatcgccggggtcctcaccattgccctgcctgtgcccgtcatcgtctccaacttcaac
tacttctaccaccgggaaacggatcacgaggagccggcagtccttaaggaagagcagggc
actcagagccaggggccggggctggacagaggagtccagcggaaggtcagcgggagcagg
ggatccttctgcaaggctggggggaccctggagaatgcagacagtgcccgaaggggcagc
tgccccctagagaagtgtaacgtcaaggccaagagcaacgtggacttgcggaggtccctt
tatgccctctgcctggacaccagccgggaaacagatttgtga

DBGET integrated database retrieval system