KEGG   Homo sapiens (human): 374378Help
Entry
374378            CDS       T01001                                 

Gene name
GALNT18, GALNACT18, GALNT15, GALNTL4, GalNAc-T15, GalNAc-T18
Definition
(RefSeq) polypeptide N-acetylgalactosaminyltransferase 18
  KO
K00710  
polypeptide N-acetylgalactosaminyltransferase [EC:2.4.1.41]
Organism
hsa  Homo sapiens (human)
Pathway
Mucin type O-glycan biosynthesis
Metabolic pathways
Module
O-glycan biosynthesis, mucin type core
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    374378 (GALNT18)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.41  polypeptide N-acetylgalactosaminyltransferase
     374378 (GALNT18)
Glycosyltransferases [BR:hsa01003]
 O-Glycan biosynthesis
  Mucin-type
   374378 (GALNT18)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q6P9A2(Tdark)
UniProt: 
Position
11p15.4
AA seq 607 aa AA seqDB search
MVCTRKTKTLVSTCVILSGMTNIICLLYVGWVTNYIASVYVRGQEPAPDKKLEEDKGDTL
KIIERLDHLENVIKQHIQEAPAKPEEAEAEPFTDSSLFAHWGQELSPEGRRVALKQFQYY
GYNAYLSDRLPLDRPLPDLRPSGCRNLSFPDSLPEVSIVFIFVNEALSVLLRSIHSAMER
TPPHLLKEIILVDDNSSNEELKEKLTEYVDKVNSQKPGFIKVVRHSKQEGLIRSRVSGWR
AATAPVVALFDAHVEFNVGWAEPVLTRIKENRKRIISPSFDNIKYDNFEIEEYPLAAQGF
DWELWCRYLNPPKAWWKLENSTAPIRSPALIGCFIVDRQYFQEIGLLDEGMEVYGGENVE
LGIRVWQCGGSVEVLPCSRIAHIERAHKPYTEDLTAHVRRNALRVAEVWMDEFKSHVYMA
WNIPQEDSGIDIGDITARKALRKQLQCKTFRWYLVSVYPEMRMYSDIIAYGVLQNSLKTD
LCLDQGPDTENVPIMYICHGMTPQNVYYTSSQQIHVGILSPTVDDDDNRCLVDVNSRPRL
IECSYAKAKRMKLHWQFSQGGPIQNRKSKRCLELQENSDLEFGFQLVLQKCSGQHWSITN
VLRSLAS
NT seq 1824 nt NT seq  +upstreamnt  +downstreamnt
atggtgtgcaccaggaagaccaaaactttggtgtccacttgcgtgatcctgagcggcatg
actaacatcatctgcctgctctacgtgggctgggtcaccaactacatcgccagcgtgtat
gtgcgggggcaggagccggcgcccgacaagaagctggaggaagacaaaggggacactctg
aagattattgagcggctggaccacctggagaatgtcatcaagcagcacattcaagaggct
cctgccaagcctgaggaggcagaggccgagcccttcacagactcctctctgtttgcacac
tggggccaggagctcagccccgaaggccggcgcgtggccctgaagcaattccagtactac
ggctacaacgcctacctcagcgaccgcctgcccctggaccggcccctgcctgacctcaga
cccagtgggtgccgtaacctctcatttcctgacagcctgccagaggtgagcatcgtgttc
atcttcgtcaatgaagcgctttcagtgctgctgcgctccatccactcggccatggaacgc
acgcccccacatctgctcaaggagatcattctggtggatgacaacagcagtaacgaggaa
ctgaaggagaagctgaccgaatatgtggacaaggtgaacagccagaagccaggcttcatc
aaagtcgtgcgtcacagcaagcaggaaggcctcatccgctccagggtcagtggctggagg
gcggccactgcccctgtggtggcactctttgatgcccacgtggagttcaatgtgggctgg
gctgaacctgtactcacccgcatcaaggagaaccggaagcggatcatctcgccatccttt
gataacatcaaatatgacaactttgagatagaagagtacccgctggctgcccagggcttt
gactgggagctgtggtgccgctacctaaatccccccaaggcctggtggaagctggagaac
tccacagcgccaatcaggagccctgccctcattggctgcttcattgtggaccggcagtac
ttccaggagatcggcctgctggacgaaggcatggaagtctacgggggcgagaatgtggag
cttgggatcagggtgtggcagtgtggcgggagtgtggaggtcctgccctgctcacggatt
gcccacattgagcgagcccacaagccctacacagaggacctcaccgcccatgtccgcagg
aacgctctcagggtggctgaagtctggatggatgaatttaaaagccacgtctacatggca
tggaacataccgcaggaggactcaggaattgacattggggacatcactgcaaggaaggct
ctcaggaaacagctgcagtgcaagaccttccggtggtacctggtcagcgtgtacccagag
atgaggatgtactccgacatcattgcctatggagtgctgcagaattctctgaagactgat
ttgtgtcttgaccaggggccagatacagagaatgtccccatcatgtacatctgccatggg
atgacgcctcagaacgtgtactacacgagcagtcagcagatccatgtgggcattctgagc
cccaccgtggatgatgatgacaaccgatgcctggtggacgtcaacagccggccccggctc
atcgaatgcagctacgccaaagccaagaggatgaagcttcactggcagttctctcaggga
ggacccatccagaaccgcaagtctaagcgctgtctggagctgcaggagaatagcgacctg
gagttcggcttccagctggtgttgcagaagtgctcgggccagcactggagcatcaccaac
gtcctgaggagcctcgcgtcctga

DBGET integrated database retrieval system