KEGG   Homo sapiens (human): 3756Help
Entry
3756              CDS       T01001                                 

Gene name
KCNH1, EAG, EAG1, Kv10.1, TMBTS, ZLS1, h-eag, hEAG1
Definition
(RefSeq) potassium voltage-gated channel subfamily H member 1
  KO
K04904  
potassium voltage-gated channel Eag-related subfamily H member 1
Organism
hsa  Homo sapiens (human)
Disease
H01573  
Zimmermann-Laband syndrome (ZLS)
Brite
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  K+ channel, KCNH, Kv10-12.x (Ether-a-go-go)
   3756 (KCNH1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1q32.2
AA seq 989 aa AA seqDB search
MTMAGGRRGLVAPQNTFLENIVRRSNDTNFVLGNAQIVDWPIVYSNDGFCKLSGYHRAEV
MQKSSTCSFMYGELTDKDTIEKVRQTFENYEMNSFEILMYKKNRTPVWFFVKIAPIRNEQ
DKVVLFLCTFSDITAFKQPIEDDSCKGWGKFARLTRALTSSRGVLQQLAPSVQKGENVHK
HSRLAEVLQLGSDILPQYKQEAPKTPPHIILHYCVFKTTWDWIILILTFYTAILVPYNVS
FKTRQNNVAWLVVDSIVDVIFLVDIVLNFHTTFVGPAGEVISDPKLIRMNYLKTWFVIDL
LSCLPYDVINAFENVDEVSAFMGDPGKIGFADQIPPPLEGRESQGISSLFSSLKVVRLLR
LGRVARKLDHYIEYGAAVLVLLVCVFGLAAHWMACIWYSIGDYEIFDEDTKTIRNNSWLY
QLAMDIGTPYQFNGSGSGKWEGGPSKNSVYISSLYFTMTSLTSVGFGNIAPSTDIEKIFA
VAIMMIGSLLYATIFGNVTTIFQQMYANTNRYHEMLNSVRDFLKLYQVPKGLSERVMDYI
VSTWSMSRGIDTEKVLQICPKDMRADICVHLNRKVFKEHPAFRLASDGCLRALAMEFQTV
HCAPGDLIYHAGESVDSLCFVVSGSLEVIQDDEVVAILGKGDVFGDVFWKEATLAQSCAN
VRALTYCDLHVIKRDALQKVLEFYTAFSHSFSRNLILTYNLRKRIVFRKISDVKREEEER
MKRKNEAPLILPPDHPVRRLFQRFRQQKEARLAAERGGRDLDDLDVEKGNVLTEHASANH
SLVKASVVTVRESPATPVSFQAASTSGVPDHAKLQAPGSECLGPKGGGGDCAKRKSWARF
KDACGKSEDWNKVSKAESMETLPERTKASGEATLKKTDSCDSGITKSDLRLDNVGEARSP
QDRSPILAEVKHSFYPIPEQTLQATVLEVRHELKEDIKALNAKMTNIEKQLSEILRILTS
RRSSQSPQELFEISRPQSPESERDIFGAS
NT seq 2970 nt NT seq  +upstreamnt  +downstreamnt
atgaccatggctgggggcaggaggggactagtggcccctcaaaacacgtttctggagaat
attgttcggcggtccaatgatactaattttgtgttggggaatgctcagatagtggactgg
cctattgtgtacagcaatgatggattttgcaagctgtctggctatcacagggcagaagtg
atgcaaaaaagcagcacctgcagttttatgtatggggagctgactgataaagacacgatt
gaaaaagtgcggcaaacatttgagaactatgagatgaattcctttgaaattctgatgtac
aagaagaacaggacacctgtgtggttctttgtgaaaattgctccaattcgaaacgaacag
gataaagtggttttatttctttgcactttcagtgacataacagctttcaaacagccaatt
gaggatgattcatgtaaaggctgggggaagtttgctcggctgacaagagcactgacaagc
agcaggggtgtcctgcagcagctggctccaagcgtgcaaaaaggcgagaatgtccacaag
cactcccgcctggcagaggtcctacagctgggctcagacatccttccccagtacaagcaa
gaggcaccaaagactccccctcacatcatcttacattattgtgtttttaagaccacgtgg
gattggatcatcttgatcttgaccttctatacagccatcttggtcccttataatgtctcc
ttcaaaaccaggcagaataatgtggcctggctggttgttgatagcatcgtggatgttatc
tttttggtggacattgtgctcaattttcataccacctttgttggaccagcaggggaggtg
atttctgaccccaaacttatccgcatgaactacctgaagacgtggtttgtgattgacctt
ctgtcctgtttgccatatgatgtcatcaacgcttttgagaacgtggatgaggttagtgcc
tttatgggtgatccagggaagattggttttgctgatcagattccaccaccactggagggg
agagagagtcagggcatcagcagcctgttcagctctctaaaagttgtccggctgctccgt
cttgggcgagtggcccgtaagctggaccactacattgaatatggagctgctgtgctggtc
ctgctggtgtgtgtgtttgggctggctgcacactggatggcctgcatctggtacagcatt
ggggactatgagatctttgacgaggacaccaagacaatccgcaacaacagctggctgtac
caactagcgatggacattggcaccccttaccagtttaatgggtctggctcagggaagtgg
gaaggtggtcccagcaagaattctgtctacatctcctcgttgtatttcacaatgaccagc
ctcaccagtgtgggctttgggaacatcgccccatccacagacattgagaagatctttgca
gtggccatcatgatgattggctcacttctctatgccaccatcttcgggaatgtgacgact
attttccaacagatgtatgccaacaccaacagataccatgagatgctcaacagtgttcgg
gacttcctgaagctctaccaggtgccaaaaggattgagtgagcgagtaatggattatatt
gtgtccacttggtccatgtccagaggcattgacacagagaaggtcctgcagatctgcccc
aaggacatgagagccgacatctgcgtgcacctgaaccgcaaggtgttcaaggagcacccg
gccttccggctggccagtgatggctgcctccgggcactggccatggagttccagacggtg
cactgtgccccaggggacctcatctaccatgcaggagagagcgttgacagcctctgcttt
gtggtttctggctccctggaggtgatccaagatgatgaggtggtggccattctaggaaaa
ggagacgtgtttggagatgtgttctggaaggaagccacccttgcccagtcctgtgccaat
gttagggccttgacctactgtgatctgcatgtgatcaagcgggatgccctgcagaaagtg
ctggaattctacacggccttctcccattccttctcccggaacctgattctgacgtacaac
ttgaggaagaggattgtgttccggaagatcagcgatgtgaaacgtgaagaggaagaacgc
atgaaacgaaagaatgaggcccccctgatcttgcccccggaccaccctgtccggcgcctc
ttccagagattccgacagcagaaagaggccaggctggcagctgagagagggggccgggac
ctggatgacctagatgtggagaagggcaatgtccttacagagcatgcctccgccaaccac
agcctcgtgaaggccagcgtggtcaccgtgcgtgagagtcctgccacgcccgtatccttc
caggcagcctccacctccggggtgccagaccacgcaaagctacaggcgccagggtccgag
tgcctgggccccaaggggggcgggggcgattgtgccaagcgcaaaagctgggcccgcttc
aaagatgcttgcgggaagagtgaggactggaacaaggtgtccaaggctgagtcgatggag
acacttcccgagaggacaaaagcgtcaggcgaggccacactgaagaagacagactcgtgt
gacagtggcatcaccaagagcgacttgcgcctggacaacgtgggtgaggccaggagtccc
caggatcggagtcccatcctggcagaggtcaagcattcgttctaccccatccctgagcag
acgctgcaggccacagtcctggaggtgaggcacgagctgaaggaggacatcaaggcctta
aacgccaaaatgaccaatattgagaaacagctctctgagatactcaggatattaacttcc
agaagatcctctcagtctcctcaggagttgtttgaaatatcgaggccacagtccccagaa
tcagagagagacatttttggagccagctga

DBGET integrated database retrieval system