KEGG   Homo sapiens (human): 3778Help
Entry
3778              CDS       T01001                                 

Gene name
KCNMA1, BKTM, KCa1.1, MaxiK, SAKCA, SLO, SLO-ALPHA, SLO1, bA205K10.1, mSLO1
Definition
potassium large conductance calcium-activated channel, subfamily M, alpha member 1
Orthology
K04936  
potassium large conductance calcium-activated channel subfamily M alpha member 1
Organism
hsa  Homo sapiens (human)
Pathway
cGMP-PKG signaling pathway
Vascular smooth muscle contraction
Insulin secretion
Salivary secretion
Pancreatic secretion
Disease
H01258  
Generalized epilepsy and paroxysmal dyskinesia (GEPD)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04022 cGMP - PKG signaling pathway
    3778 (KCNMA1)
 Organismal Systems
  Endocrine system
   04911 Insulin secretion
    3778 (KCNMA1)
  Circulatory system
   04270 Vascular smooth muscle contraction
    3778 (KCNMA1)
  Digestive system
   04970 Salivary secretion
    3778 (KCNMA1)
   04972 Pancreatic secretion
    3778 (KCNMA1)
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  K+ channel, KCNM, KCa1.x
   3778 (KCNMA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
10q22.3
AA seq 1182 aa AA seqDB search
MANGGGGGGGSSGGGGGGGGSSLRMSSNIHANHLSLDASSSSSSSSSSSSSSSSSSSSSS
VHEPKMDALIIPVTMEVPCDSRGQRMWWAFLASSMVTFFGGLFIILLWRTLKYLWTVCCH
CGGKTKEAQKINNGSSQADGTLKPVDEKEEAVAAEVGWMTSVKDWAGVMISAQTLTGRVL
VVLVFALSIGALVIYFIDSSNPIESCQNFYKDFTLQIDMAFNVFFLLYFGLRFIAANDKL
WFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLNILKTSNSIKL
VNLLSIFISTWLTAAGFIHLVENSGDPWENFQNNQALTYWECVYLLMVTMSTVGYGDVYA
KTTLGRLFMVFFILGGLAMFASYVPEIIELIGNRKKYGGSYSAVSGRKHIVVCGHITLES
VSNFLKDFLHKDRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVK
IESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSW
NWKEGDDAICLAELKLGFIAQSCLAQGLSTMLANLFSMRSFIKIEEDTWQKYYLEGVSNE
MYTEYLSSAFVGLSFPTVCELCFVKLKLLMIAIEYKSANRESRSRKRILINPGNHLKIQE
GTLGFFIASDAKEVKRAFFYCKACHDDITDPKRIKKCGCKRLEDEQPSTLSPKKKQRNGG
MRNSPNTSPKLMRHDPLLIPGNDQIDNMDSNVKKYDSTGMFHWCAPKEIEKVILTRSEAA
MTVLSGHVVVCIFGDVSSALIGLRNLVMPLRASNFHYHELKHIVFVGSIEYLKREWETLH
NFPKVSILPGTPLSRADLRAVNINLCDMCVILSANQNNIDDTSLQDKECILASLNIKSMQ
FDDSIGVLQANSQGFTPPGMDRSSPDNSPVHGMLRQPSITTGVNIPIITELVNDTNVQFL
DQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPELEA
LIAEENALRGGYSTPQTLANRDRCRVAQLALLDGPFADLGDGGCYGDLFCKALKTYNMLC
FGIYRLRDAHLSTPSQCTKRYVITNPPYEFELVPTDLIFCLMQFDHNAGQSRASLSHSSH
SSQSSSKKSSSVHSIPSTANRQNRPKSRESRDKQNRKEMVYR
NT seq 3549 nt NT seq  +upstreamnt  +downstreamnt
atggcaaatggtggcggcggcggcggcggcagcagcggcggcggcggcggcggcggaggc
agcagtcttagaatgagtagcaatatccacgcgaaccatctcagcctagacgcgtcctcc
tcctcctcctcctcctcttcctcttcttcttcttcctcctcctcttcctcctcgtcctcg
gtccacgagcccaagatggatgcgctcatcatcccggtgaccatggaggtgccgtgcgac
agccggggccaacgcatgtggtgggctttcctggcctcctccatggtgactttcttcggg
ggcctcttcatcatcttgctctggcggacgctcaagtacctgtggaccgtgtgctgccac
tgcgggggcaagacgaaggaggcccagaagattaacaatggctcaagccaggcggatggc
actctcaaaccagtggatgaaaaagaggaggcagtggccgccgaggtcggctggatgacc
tccgtgaaggactgggcgggggtgatgatatccgcccagacactgactggcagagtcctg
gttgtcttagtctttgctctcagcatcggtgcacttgtaatatacttcatagattcatca
aacccaatagaatcctgccagaatttctacaaagatttcacattacagatcgacatggct
ttcaacgtgttcttccttctctacttcggcttgcggtttattgcagccaacgataaattg
tggttctggctggaagtgaactctgtagtggatttcttcacggtgccccccgtgtttgtg
tctgtgtacttaaacagaagttggcttggtttgagatttttaagagctctgagactgata
cagttttcagaaattttgcagtttctgaatattcttaaaacaagtaattccatcaagctg
gtgaatctgctctccatatttatcagcacgtggctgactgcagccgggttcatccatttg
gtggagaattcaggggacccatgggaaaatttccaaaacaaccaggctctcacctactgg
gaatgtgtctatttactcatggtcacaatgtccaccgttggttatggggatgtttatgca
aaaaccacacttgggcgcctcttcatggtcttcttcatcctcgggggactggccatgttt
gccagctacgtccctgaaatcatagagttaataggaaaccgcaagaaatacgggggctcc
tatagtgcggttagtggaagaaagcacattgtggtctgcggacacatcactctggagagt
gtttccaacttcctgaaggactttctgcacaaggaccgggatgacgtcaatgtggagatc
gtttttcttcacaacatctcccccaacctggagcttgaagctctgttcaaacgacatttt
actcaggtggaattttatcagggttccgtcctcaatccacatgatcttgcaagagtcaag
atagagtcagcagatgcatgcctgatccttgccaacaagtactgcgctgacccggatgcg
gaggatgcctcgaatatcatgagagtaatctccataaagaactaccatccgaagataaga
atcatcactcaaatgctgcagtatcacaacaaggcccatctgctaaacatcccgagctgg
aattggaaagaaggtgatgacgcaatctgcctcgcagagttgaagttgggcttcatagcc
cagagctgcctggctcaaggcctctccaccatgcttgccaacctcttctccatgaggtca
ttcataaagattgaggaagacacatggcagaaatactacttggaaggagtctcaaatgaa
atgtacacagaatatctctccagtgccttcgtgggtctgtccttccctactgtttgtgag
ctgtgttttgtgaagctcaagctcctaatgatagccattgagtacaagtctgccaaccga
gagagccgaagccgaaagcgtatattaattaatcctggaaaccatcttaagatccaagaa
ggtactttaggatttttcatcgcaagtgatgccaaagaagttaaaagggcatttttttac
tgcaaggcctgtcatgatgacatcacagatcccaaaagaataaaaaaatgtggctgcaaa
cggcttgaagatgagcagccgtcaacactatcaccaaaaaaaaagcaacggaatggaggc
atgcggaactcacccaacacctcgcctaagctgatgaggcatgaccccttgttaattcct
ggcaatgatcagattgacaacatggactccaatgtgaagaagtacgactctactgggatg
tttcactggtgtgcacccaaggagatagagaaagtcatcctgactcgaagtgaagctgcc
atgaccgtcctgagtggccatgtcgtggtctgcatctttggcgacgtcagctcagccctg
atcggcctccggaacctggtgatgccgctccgtgccagcaactttcattaccatgagctc
aagcacattgtgtttgtgggctctattgagtacctcaagcgggaatgggagacgcttcat
aacttccccaaagtgtccatattgcctggtacgccattaagtcgggctgatttaagggct
gtcaacatcaacctctgtgacatgtgcgttatcctgtcagccaatcagaataatattgat
gatacttcgctgcaggacaaggaatgcatcttggcgtcactcaacatcaaatctatgcag
tttgatgacagcatcggagtcttgcaggctaattcccaagggttcacacctccaggaatg
gatagatcctctccagataacagcccagtgcacgggatgttacgtcaaccatccatcaca
actggggtcaacatccccatcatcactgaactagtgaacgatactaatgttcagtttttg
gaccaagacgatgatgatgaccctgatacagaactgtacctcacgcagccctttgcctgt
gggacagcatttgccgtcagtgtcctggactcactcatgagcgcgacgtacttcaatgac
aatatcctcaccctgatacggaccctggtgaccggaggagccacgccggagctggaggct
ctgattgctgaggaaaacgcccttagaggtggctacagcaccccgcagacactggccaat
agggaccgctgccgcgtggcccagttagctctgctcgatgggccatttgcggacttaggg
gatggtggttgttatggtgatctgttctgcaaagctctgaaaacatataatatgctttgt
tttggaatttaccggctgagagatgctcacctcagcacccccagtcagtgcacaaagagg
tatgtcatcaccaacccgccctatgagtttgagctcgtgccgacggacctgatcttctgc
ttaatgcagtttgaccacaatgccggccagtcccgggccagcctgtcccattcctcccac
tcgtcgcagtcctccagcaagaagagctcctctgttcactccatcccatccacagcaaac
cgacagaaccggcccaagtccagggagtcccgggacaaacagaacagaaaagaaatggtt
tacagatga

DBGET integrated database retrieval system