KEGG   Homo sapiens (human): 3783Help
Entry
3783              CDS       T01001                                 

Gene name
KCNN4, DHS2, IK, IK1, IKCA1, KCA4, KCa3.1, SK4, hIKCa1, hKCa4, hSK4
Definition
(RefSeq) potassium calcium-activated channel subfamily N member 4
  KO
K04945  potassium intermediate/small conductance calcium-activated channel subfamily N member 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04911  Insulin secretion
hsa04970  Salivary secretion
hsa04974  Protein digestion and absorption
Disease
H00232  Hereditary stomatocytosis (HSt)
H01978  Dehydrated hereditary stomatocytosis
Drug target
Senicapoc: D06640
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Endocrine system
   04911 Insulin secretion
    3783 (KCNN4)
  Digestive system
   04970 Salivary secretion
    3783 (KCNN4)
   04974 Protein digestion and absorption
    3783 (KCNN4)
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  K+ channel, KCNN, KCa2-3.x (Small conductance)
   3783 (KCNN4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SK_channel CaMBD Ion_trans_2 Ion_trans
Motif
Other DBs
NCBI-GeneID: 3783
NCBI-ProteinID: NP_002241
OMIM: 602754
HGNC: 6293
Ensembl: ENSG00000104783
Vega: OTTHUMG00000182779
Pharos: O15554(Tchem)
UniProt: O15554
Position
19q13.31
AA seq 427 aa AA seqDB search
MGGDLVLGLGALRRRKRLLEQEKSLAGWALVLAGTGIGLMVLHAEMLWFGGCSWALYLFL
VKCTISISTFLLLCLIVAFHAKEVQLFMTDNGLRDWRVALTGRQAAQIVLELVVCGLHPA
PVRGPPCVQDLGAPLTSPQPWPGFLGQGEALLSLAMLLRLYLVPRAVLLRSGVLLNASYR
SIGALNQVRFRHWFVAKLYMNTHPGRLLLGLTLGLWLTTAWVLSVAERQAVNATGHLSDT
LWLIPITFLTIGYGDVVPGTMWGKIVCLCTGVMGVCCTALLVAVVARKLEFNKAEKHVHN
FMMDIQYTKEMKESAARVLQEAWMFYKHTRRKESHAARRHQRKLLAAINAFRQVRLKHRK
LREQVNSMVDISKMHMILYDLQQNLSSSHRALEKQIDTLAGKLDALTELLSTALGPRQLP
EPSQQSK
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgggcggggatctggtgcttggcctgggggccttgagacgccgaaagcgcttgctggag
caggagaagtctctggccggctgggcactggtgctggcaggaactggcattggactcatg
gtgctgcatgcagagatgctgtggttcggggggtgctcgtgggcgctctacctgttcctg
gttaaatgcacgatcagcatttccaccttcttactcctctgcctcatcgtggcctttcat
gccaaagaggtccagctgttcatgaccgacaacgggctgcgggactggcgcgtggcgctg
accgggcggcaggcggcgcagatcgtgctggagctggtggtgtgtgggctgcacccggcg
cccgtgcggggcccgccgtgcgtgcaggatttaggggcgccgctgacctccccgcagccc
tggccgggattcctgggccaaggggaagcgctgctgtccctggccatgctgctgcgtctc
tacctggtgccccgcgccgtgctcctgcgcagcggcgtcctgctcaacgcttcctaccgc
agcatcggcgctctcaatcaagtccgcttccgccactggttcgtggccaagctttacatg
aacacgcaccctggccgcctgctgctcggcctcacgcttggcctctggctgaccaccgcc
tgggtgctgtccgtggccgagaggcaggctgttaatgccactgggcacctttcagacaca
ctttggctgatccccatcacattcctgaccatcggctatggtgacgtggtgccgggcacc
atgtggggcaagatcgtctgcctgtgcactggagtcatgggtgtctgctgcacagccctg
ctggtggccgtggtggcccggaagctggagtttaacaaggcagagaagcacgtgcacaac
ttcatgatggatatccagtataccaaagagatgaaggagtccgctgcccgagtgctacaa
gaagcctggatgttctacaaacatactcgcaggaaggagtctcatgctgcccgcaggcat
cagcgcaagctgctggccgccatcaacgcgttccgccaggtgcggctgaaacaccggaag
ctccgggaacaagtgaactccatggtggacatctccaagatgcacatgatcctgtatgac
ctgcagcagaatctgagcagctcacaccgggccctggagaaacagattgacacgctggcg
gggaagctggatgccctgactgagctgcttagcactgccctggggccgaggcagcttcca
gaacccagccagcagtccaagtag

DBGET integrated database retrieval system