KEGG   Homo sapiens (human): 3791Help
Entry
3791              CDS       T01001                                 

Gene name
KDR, CD309, FLK1, VEGFR, VEGFR2
Definition
kinase insert domain receptor (a type III receptor tyrosine kinase) (EC:2.7.10.1)
Orthology
K05098  
kinase insert domain protein receptor [EC:2.7.10.1]
Organism
hsa  Homo sapiens (human)
Pathway
Ras signaling pathway
Rap1 signaling pathway
Cytokine-cytokine receptor interaction
Endocytosis
PI3K-Akt signaling pathway
VEGF signaling pathway
Focal adhesion
Proteoglycans in cancer
Drug target
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    3791 (KDR)
   04015 Rap1 signaling pathway
    3791 (KDR)
   04370 VEGF signaling pathway
    3791 (KDR)
   04151 PI3K-Akt signaling pathway
    3791 (KDR)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3791 (KDR)
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    3791 (KDR)
  Cell communication
   04510 Focal adhesion
    3791 (KDR)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    3791 (KDR)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     3791 (KDR)
Protein kinases [BR:hsa01001]
 Tyrosine protein kinases
  VEGFR family [OT]
   3791 (KDR)
Enzyme-linked receptors [BR:hsa01020]
 Receptor tyrosine kinases
  RTK class V (VEGF receptor family)
   3791 (KDR)
Cytokine receptors [BR:hsa04050]
 Receptor tyrosine kinase
  RTK class V (VEGF receptor family)
   3791 (KDR)
Cellular antigens [BR:hsa04090]
 Proteins
  3791 (KDR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
4q11-q12
AA seq 1356 aa AA seqDB search
MQSKVLLAVALWLCVETRAASVGLPSVSLDLPRLSIQKDILTIKANTTLQITCRGQRDLD
WLWPNNQSGSEQRVEVTECSDGLFCKTLTIPKVIGNDTGAYKCFYRETDLASVIYVYVQD
YRSPFIASVSDQHGVVYITENKNKTVVIPCLGSISNLNVSLCARYPEKRFVPDGNRISWD
SKKGFTIPSYMISYAGMVFCEAKINDESYQSIMYIVVVVGYRIYDVVLSPSHGIELSVGE
KLVLNCTARTELNVGIDFNWEYPSSKHQHKKLVNRDLKTQSGSEMKKFLSTLTIDGVTRS
DQGLYTCAASSGLMTKKNSTFVRVHEKPFVAFGSGMESLVEATVGERVRIPAKYLGYPPP
EIKWYKNGIPLESNHTIKAGHVLTIMEVSERDTGNYTVILTNPISKEKQSHVVSLVVYVP
PQIGEKSLISPVDSYQYGTTQTLTCTVYAIPPPHHIHWYWQLEEECANEPSQAVSVTNPY
PCEEWRSVEDFQGGNKIEVNKNQFALIEGKNKTVSTLVIQAANVSALYKCEAVNKVGRGE
RVISFHVTRGPEITLQPDMQPTEQESVSLWCTADRSTFENLTWYKLGPQPLPIHVGELPT
PVCKNLDTLWKLNATMFSNSTNDILIMELKNASLQDQGDYVCLAQDRKTKKRHCVVRQLT
VLERVAPTITGNLENQTTSIGESIEVSCTASGNPPPQIMWFKDNETLVEDSGIVLKDGNR
NLTIRRVRKEDEGLYTCQACSVLGCAKVEAFFIIEGAQEKTNLEIIILVGTAVIAMFFWL
LLVIILRTVKRANGGELKTGYLSIVMDPDELPLDEHCERLPYDASKWEFPRDRLKLGKPL
GRGAFGQVIEADAFGIDKTATCRTVAVKMLKEGATHSEHRALMSELKILIHIGHHLNVVN
LLGACTKPGGPLMVIVEFCKFGNLSTYLRSKRNEFVPYKTKGARFRQGKDYVGAIPVDLK
RRLDSITSSQSSASSGFVEEKSLSDVEEEEAPEDLYKDFLTLEHLICYSFQVAKGMEFLA
SRKCIHRDLAARNILLSEKNVVKICDFGLARDIYKDPDYVRKGDARLPLKWMAPETIFDR
VYTIQSDVWSFGVLLWEIFSLGASPYPGVKIDEEFCRRLKEGTRMRAPDYTTPEMYQTML
DCWHGEPSQRPTFSELVEHLGNLLQANAQQDGKDYIVLPISETLSMEEDSGLSLPTSPVS
CMEEEEVCDPKFHYDNTAGISQYLQNSKRKSRPVSVKTFEDIPLEEPEVKVIPDDNQTDS
GMVLASEELKTLEDRTKLSPSFGGMVPSKSRESVASEGSNQTSGYQSGYHSDDTDTTVYS
SEEAELLKLIEIGVQTGSTAQILQPDSGTTLSSPPV
NT seq 4071 nt NT seq  +upstreamnt  +downstreamnt
atgcagagcaaggtgctgctggccgtcgccctgtggctctgcgtggagacccgggccgcc
tctgtgggtttgcctagtgtttctcttgatctgcccaggctcagcatacaaaaagacata
cttacaattaaggctaatacaactcttcaaattacttgcaggggacagagggacttggac
tggctttggcccaataatcagagtggcagtgagcaaagggtggaggtgactgagtgcagc
gatggcctcttctgtaagacactcacaattccaaaagtgatcggaaatgacactggagcc
tacaagtgcttctaccgggaaactgacttggcctcggtcatttatgtctatgttcaagat
tacagatctccatttattgcttctgttagtgaccaacatggagtcgtgtacattactgag
aacaaaaacaaaactgtggtgattccatgtctcgggtccatttcaaatctcaacgtgtca
ctttgtgcaagatacccagaaaagagatttgttcctgatggtaacagaatttcctgggac
agcaagaagggctttactattcccagctacatgatcagctatgctggcatggtcttctgt
gaagcaaaaattaatgatgaaagttaccagtctattatgtacatagttgtcgttgtaggg
tataggatttatgatgtggttctgagtccgtctcatggaattgaactatctgttggagaa
aagcttgtcttaaattgtacagcaagaactgaactaaatgtggggattgacttcaactgg
gaatacccttcttcgaagcatcagcataagaaacttgtaaaccgagacctaaaaacccag
tctgggagtgagatgaagaaatttttgagcaccttaactatagatggtgtaacccggagt
gaccaaggattgtacacctgtgcagcatccagtgggctgatgaccaagaagaacagcaca
tttgtcagggtccatgaaaaaccttttgttgcttttggaagtggcatggaatctctggtg
gaagccacggtgggggagcgtgtcagaatccctgcgaagtaccttggttacccaccccca
gaaataaaatggtataaaaatggaataccccttgagtccaatcacacaattaaagcgggg
catgtactgacgattatggaagtgagtgaaagagacacaggaaattacactgtcatcctt
accaatcccatttcaaaggagaagcagagccatgtggtctctctggttgtgtatgtccca
ccccagattggtgagaaatctctaatctctcctgtggattcctaccagtacggcaccact
caaacgctgacatgtacggtctatgccattcctcccccgcatcacatccactggtattgg
cagttggaggaagagtgcgccaacgagcccagccaagctgtctcagtgacaaacccatac
ccttgtgaagaatggagaagtgtggaggacttccagggaggaaataaaattgaagttaat
aaaaatcaatttgctctaattgaaggaaaaaacaaaactgtaagtacccttgttatccaa
gcggcaaatgtgtcagctttgtacaaatgtgaagcggtcaacaaagtcgggagaggagag
agggtgatctccttccacgtgaccaggggtcctgaaattactttgcaacctgacatgcag
cccactgagcaggagagcgtgtctttgtggtgcactgcagacagatctacgtttgagaac
ctcacatggtacaagcttggcccacagcctctgccaatccatgtgggagagttgcccaca
cctgtttgcaagaacttggatactctttggaaattgaatgccaccatgttctctaatagc
acaaatgacattttgatcatggagcttaagaatgcatccttgcaggaccaaggagactat
gtctgccttgctcaagacaggaagaccaagaaaagacattgcgtggtcaggcagctcaca
gtcctagagcgtgtggcacccacgatcacaggaaacctggagaatcagacgacaagtatt
ggggaaagcatcgaagtctcatgcacggcatctgggaatccccctccacagatcatgtgg
tttaaagataatgagacccttgtagaagactcaggcattgtattgaaggatgggaaccgg
aacctcactatccgcagagtgaggaaggaggacgaaggcctctacacctgccaggcatgc
agtgttcttggctgtgcaaaagtggaggcatttttcataatagaaggtgcccaggaaaag
acgaacttggaaatcattattctagtaggcacggcggtgattgccatgttcttctggcta
cttcttgtcatcatcctacggaccgttaagcgggccaatggaggggaactgaagacaggc
tacttgtccatcgtcatggatccagatgaactcccattggatgaacattgtgaacgactg
ccttatgatgccagcaaatgggaattccccagagaccggctgaagctaggtaagcctctt
ggccgtggtgcctttggccaagtgattgaagcagatgcctttggaattgacaagacagca
acttgcaggacagtagcagtcaaaatgttgaaagaaggagcaacacacagtgagcatcga
gctctcatgtctgaactcaagatcctcattcatattggtcaccatctcaatgtggtcaac
cttctaggtgcctgtaccaagccaggagggccactcatggtgattgtggaattctgcaaa
tttggaaacctgtccacttacctgaggagcaagagaaatgaatttgtcccctacaagacc
aaaggggcacgattccgtcaagggaaagactacgttggagcaatccctgtggatctgaaa
cggcgcttggacagcatcaccagtagccagagctcagccagctctggatttgtggaggag
aagtccctcagtgatgtagaagaagaggaagctcctgaagatctgtataaggacttcctg
accttggagcatctcatctgttacagcttccaagtggctaagggcatggagttcttggca
tcgcgaaagtgtatccacagggacctggcggcacgaaatatcctcttatcggagaagaac
gtggttaaaatctgtgactttggcttggcccgggatatttataaagatccagattatgtc
agaaaaggagatgctcgcctccctttgaaatggatggccccagaaacaatttttgacaga
gtgtacacaatccagagtgacgtctggtcttttggtgttttgctgtgggaaatattttcc
ttaggtgcttctccatatcctggggtaaagattgatgaagaattttgtaggcgattgaaa
gaaggaactagaatgagggcccctgattatactacaccagaaatgtaccagaccatgctg
gactgctggcacggggagcccagtcagagacccacgttttcagagttggtggaacatttg
ggaaatctcttgcaagctaatgctcagcaggatggcaaagactacattgttcttccgata
tcagagactttgagcatggaagaggattctggactctctctgcctacctcacctgtttcc
tgtatggaggaggaggaagtatgtgaccccaaattccattatgacaacacagcaggaatc
agtcagtatctgcagaacagtaagcgaaagagccggcctgtgagtgtaaaaacatttgaa
gatatcccgttagaagaaccagaagtaaaagtaatcccagatgacaaccagacggacagt
ggtatggttcttgcctcagaagagctgaaaactttggaagacagaaccaaattatctcca
tcttttggtggaatggtgcccagcaaaagcagggagtctgtggcatctgaaggctcaaac
cagacaagcggctaccagtccggatatcactccgatgacacagacaccaccgtgtactcc
agtgaggaagcagaacttttaaagctgatagagattggagtgcaaaccggtagcacagcc
cagattctccagcctgactcggggaccacactgagctctcctcctgtttaa

DBGET integrated database retrieval system