KEGG   Homo sapiens (human): 3791Help
Entry
3791              CDS       T01001                                 

Gene name
KDR, CD309, FLK1, VEGFR, VEGFR2
Definition
(RefSeq) kinase insert domain receptor
  KO
K05098  kinase insert domain protein receptor [EC:2.7.10.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa01521  EGFR tyrosine kinase inhibitor resistance
hsa04010  MAPK signaling pathway
hsa04014  Ras signaling pathway
hsa04015  Rap1 signaling pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04151  PI3K-Akt signaling pathway
hsa04370  VEGF signaling pathway
hsa04510  Focal adhesion
hsa05205  Proteoglycans in cancer
hsa05418  Fluid shear stress and atherosclerosis
Disease
H01482  Infantile hemangioma
Drug target
Altiratinib: D10862
Axitinib: D03218
Brivanib (DG01373): D08878 D09589
Cabozantinib (DG01670): D10062 D10095
Cediranib (DG01360): D08881 D08883
Dovitinib lactate: D08907
Foretinib: D09618
Golvatinib (DG01367): D10224 D10465
Lenvatinib (DG01362): D09919 D09920
Linifanib: D09635
Midostaurin: D05029
Motesanib (DG01262): D06678 D08947
Nintedanib (DG01374): D10396 D10481
Pazopanib: D05380
Pegdinetanib: D09945
Ramucirumab: D09371
Regorafenib (DG00720): D10137 D10138
Semaxanib: D05819
Sorafenib (DG00713): D06272 D08524
Sunitinib (DG00712): D06402 D08552
Tivozanib (DG01375): D09683 D10190
Toceranib (DG01363): D08503 D08544
Vandetanib: D06407
Vatalanib: D06285
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    3791 (KDR)
   04015 Rap1 signaling pathway
    3791 (KDR)
   04010 MAPK signaling pathway
    3791 (KDR)
   04370 VEGF signaling pathway
    3791 (KDR)
   04151 PI3K-Akt signaling pathway
    3791 (KDR)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3791 (KDR)
 Cellular Processes
  Cellular community - eukaryotes
   04510 Focal adhesion
    3791 (KDR)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    3791 (KDR)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    3791 (KDR)
  Drug resistance
   01521 EGFR tyrosine kinase inhibitor resistance
    3791 (KDR)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     3791 (KDR)
Protein kinases [BR:hsa01001]
 Receptor tyrosine kinases (RTK)
  VEGFR family [OT]
   3791 (KDR)
CD molecules [BR:hsa04090]
 Proteins
  3791 (KDR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Ig_3 I-set Pkinase ig Ig_2 V-set C2-set_2 Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 3791
NCBI-ProteinID: NP_002244
OMIM: 191306
HGNC: 6307
Ensembl: ENSG00000128052
Vega: OTTHUMG00000128734
Pharos: P35968(Tclin)
UniProt: P35968 A0A024RD88
Structure
PDB: 

Jmol
Position
4q12
AA seq 1356 aa AA seqDB search
MQSKVLLAVALWLCVETRAASVGLPSVSLDLPRLSIQKDILTIKANTTLQITCRGQRDLD
WLWPNNQSGSEQRVEVTECSDGLFCKTLTIPKVIGNDTGAYKCFYRETDLASVIYVYVQD
YRSPFIASVSDQHGVVYITENKNKTVVIPCLGSISNLNVSLCARYPEKRFVPDGNRISWD
SKKGFTIPSYMISYAGMVFCEAKINDESYQSIMYIVVVVGYRIYDVVLSPSHGIELSVGE
KLVLNCTARTELNVGIDFNWEYPSSKHQHKKLVNRDLKTQSGSEMKKFLSTLTIDGVTRS
DQGLYTCAASSGLMTKKNSTFVRVHEKPFVAFGSGMESLVEATVGERVRIPAKYLGYPPP
EIKWYKNGIPLESNHTIKAGHVLTIMEVSERDTGNYTVILTNPISKEKQSHVVSLVVYVP
PQIGEKSLISPVDSYQYGTTQTLTCTVYAIPPPHHIHWYWQLEEECANEPSQAVSVTNPY
PCEEWRSVEDFQGGNKIEVNKNQFALIEGKNKTVSTLVIQAANVSALYKCEAVNKVGRGE
RVISFHVTRGPEITLQPDMQPTEQESVSLWCTADRSTFENLTWYKLGPQPLPIHVGELPT
PVCKNLDTLWKLNATMFSNSTNDILIMELKNASLQDQGDYVCLAQDRKTKKRHCVVRQLT
VLERVAPTITGNLENQTTSIGESIEVSCTASGNPPPQIMWFKDNETLVEDSGIVLKDGNR
NLTIRRVRKEDEGLYTCQACSVLGCAKVEAFFIIEGAQEKTNLEIIILVGTAVIAMFFWL
LLVIILRTVKRANGGELKTGYLSIVMDPDELPLDEHCERLPYDASKWEFPRDRLKLGKPL
GRGAFGQVIEADAFGIDKTATCRTVAVKMLKEGATHSEHRALMSELKILIHIGHHLNVVN
LLGACTKPGGPLMVIVEFCKFGNLSTYLRSKRNEFVPYKTKGARFRQGKDYVGAIPVDLK
RRLDSITSSQSSASSGFVEEKSLSDVEEEEAPEDLYKDFLTLEHLICYSFQVAKGMEFLA
SRKCIHRDLAARNILLSEKNVVKICDFGLARDIYKDPDYVRKGDARLPLKWMAPETIFDR
VYTIQSDVWSFGVLLWEIFSLGASPYPGVKIDEEFCRRLKEGTRMRAPDYTTPEMYQTML
DCWHGEPSQRPTFSELVEHLGNLLQANAQQDGKDYIVLPISETLSMEEDSGLSLPTSPVS
CMEEEEVCDPKFHYDNTAGISQYLQNSKRKSRPVSVKTFEDIPLEEPEVKVIPDDNQTDS
GMVLASEELKTLEDRTKLSPSFGGMVPSKSRESVASEGSNQTSGYQSGYHSDDTDTTVYS
SEEAELLKLIEIGVQTGSTAQILQPDSGTTLSSPPV
NT seq 4071 nt NT seq  +upstreamnt  +downstreamnt
atgcagagcaaggtgctgctggccgtcgccctgtggctctgcgtggagacccgggccgcc
tctgtgggtttgcctagtgtttctcttgatctgcccaggctcagcatacaaaaagacata
cttacaattaaggctaatacaactcttcaaattacttgcaggggacagagggacttggac
tggctttggcccaataatcagagtggcagtgagcaaagggtggaggtgactgagtgcagc
gatggcctcttctgtaagacactcacaattccaaaagtgatcggaaatgacactggagcc
tacaagtgcttctaccgggaaactgacttggcctcggtcatttatgtctatgttcaagat
tacagatctccatttattgcttctgttagtgaccaacatggagtcgtgtacattactgag
aacaaaaacaaaactgtggtgattccatgtctcgggtccatttcaaatctcaacgtgtca
ctttgtgcaagatacccagaaaagagatttgttcctgatggtaacagaatttcctgggac
agcaagaagggctttactattcccagctacatgatcagctatgctggcatggtcttctgt
gaagcaaaaattaatgatgaaagttaccagtctattatgtacatagttgtcgttgtaggg
tataggatttatgatgtggttctgagtccgtctcatggaattgaactatctgttggagaa
aagcttgtcttaaattgtacagcaagaactgaactaaatgtggggattgacttcaactgg
gaatacccttcttcgaagcatcagcataagaaacttgtaaaccgagacctaaaaacccag
tctgggagtgagatgaagaaatttttgagcaccttaactatagatggtgtaacccggagt
gaccaaggattgtacacctgtgcagcatccagtgggctgatgaccaagaagaacagcaca
tttgtcagggtccatgaaaaaccttttgttgcttttggaagtggcatggaatctctggtg
gaagccacggtgggggagcgtgtcagaatccctgcgaagtaccttggttacccaccccca
gaaataaaatggtataaaaatggaataccccttgagtccaatcacacaattaaagcgggg
catgtactgacgattatggaagtgagtgaaagagacacaggaaattacactgtcatcctt
accaatcccatttcaaaggagaagcagagccatgtggtctctctggttgtgtatgtccca
ccccagattggtgagaaatctctaatctctcctgtggattcctaccagtacggcaccact
caaacgctgacatgtacggtctatgccattcctcccccgcatcacatccactggtattgg
cagttggaggaagagtgcgccaacgagcccagccaagctgtctcagtgacaaacccatac
ccttgtgaagaatggagaagtgtggaggacttccagggaggaaataaaattgaagttaat
aaaaatcaatttgctctaattgaaggaaaaaacaaaactgtaagtacccttgttatccaa
gcggcaaatgtgtcagctttgtacaaatgtgaagcggtcaacaaagtcgggagaggagag
agggtgatctccttccacgtgaccaggggtcctgaaattactttgcaacctgacatgcag
cccactgagcaggagagcgtgtctttgtggtgcactgcagacagatctacgtttgagaac
ctcacatggtacaagcttggcccacagcctctgccaatccatgtgggagagttgcccaca
cctgtttgcaagaacttggatactctttggaaattgaatgccaccatgttctctaatagc
acaaatgacattttgatcatggagcttaagaatgcatccttgcaggaccaaggagactat
gtctgccttgctcaagacaggaagaccaagaaaagacattgcgtggtcaggcagctcaca
gtcctagagcgtgtggcacccacgatcacaggaaacctggagaatcagacgacaagtatt
ggggaaagcatcgaagtctcatgcacggcatctgggaatccccctccacagatcatgtgg
tttaaagataatgagacccttgtagaagactcaggcattgtattgaaggatgggaaccgg
aacctcactatccgcagagtgaggaaggaggacgaaggcctctacacctgccaggcatgc
agtgttcttggctgtgcaaaagtggaggcatttttcataatagaaggtgcccaggaaaag
acgaacttggaaatcattattctagtaggcacggcggtgattgccatgttcttctggcta
cttcttgtcatcatcctacggaccgttaagcgggccaatggaggggaactgaagacaggc
tacttgtccatcgtcatggatccagatgaactcccattggatgaacattgtgaacgactg
ccttatgatgccagcaaatgggaattccccagagaccggctgaagctaggtaagcctctt
ggccgtggtgcctttggccaagtgattgaagcagatgcctttggaattgacaagacagca
acttgcaggacagtagcagtcaaaatgttgaaagaaggagcaacacacagtgagcatcga
gctctcatgtctgaactcaagatcctcattcatattggtcaccatctcaatgtggtcaac
cttctaggtgcctgtaccaagccaggagggccactcatggtgattgtggaattctgcaaa
tttggaaacctgtccacttacctgaggagcaagagaaatgaatttgtcccctacaagacc
aaaggggcacgattccgtcaagggaaagactacgttggagcaatccctgtggatctgaaa
cggcgcttggacagcatcaccagtagccagagctcagccagctctggatttgtggaggag
aagtccctcagtgatgtagaagaagaggaagctcctgaagatctgtataaggacttcctg
accttggagcatctcatctgttacagcttccaagtggctaagggcatggagttcttggca
tcgcgaaagtgtatccacagggacctggcggcacgaaatatcctcttatcggagaagaac
gtggttaaaatctgtgactttggcttggcccgggatatttataaagatccagattatgtc
agaaaaggagatgctcgcctccctttgaaatggatggccccagaaacaatttttgacaga
gtgtacacaatccagagtgacgtctggtcttttggtgttttgctgtgggaaatattttcc
ttaggtgcttctccatatcctggggtaaagattgatgaagaattttgtaggcgattgaaa
gaaggaactagaatgagggcccctgattatactacaccagaaatgtaccagaccatgctg
gactgctggcacggggagcccagtcagagacccacgttttcagagttggtggaacatttg
ggaaatctcttgcaagctaatgctcagcaggatggcaaagactacattgttcttccgata
tcagagactttgagcatggaagaggattctggactctctctgcctacctcacctgtttcc
tgtatggaggaggaggaagtatgtgaccccaaattccattatgacaacacagcaggaatc
agtcagtatctgcagaacagtaagcgaaagagccggcctgtgagtgtaaaaacatttgaa
gatatcccgttagaagaaccagaagtaaaagtaatcccagatgacaaccagacggacagt
ggtatggttcttgcctcagaagagctgaaaactttggaagacagaaccaaattatctcca
tcttttggtggaatggtgcccagcaaaagcagggagtctgtggcatctgaaggctcaaac
cagacaagcggctaccagtccggatatcactccgatgacacagacaccaccgtgtactcc
agtgaggaagcagaacttttaaagctgatagagattggagtgcaaaccggtagcacagcc
cagattctccagcctgactcggggaccacactgagctctcctcctgtttaa

DBGET integrated database retrieval system