KEGG   Homo sapiens (human): 3791Help
Entry
3791              CDS       T01001                                 

Gene name
KDR, CD309, FLK1, VEGFR, VEGFR2
Definition
kinase insert domain receptor (a type III receptor tyrosine kinase) (EC:2.7.10.1)
Orthology
K05098  
kinase insert domain protein receptor [EC:2.7.10.1]
Organism
hsa  Homo sapiens (human)
Pathway
Ras signaling pathway
Rap1 signaling pathway
Cytokine-cytokine receptor interaction
Endocytosis
PI3K-Akt signaling pathway
VEGF signaling pathway
Focal adhesion
Proteoglycans in cancer
Drug target
Class
Environmental Information Processing; Signal transduction; Ras signaling pathway [PATH:hsa04014]
Environmental Information Processing; Signal transduction; Rap1 signaling pathway [PATH:hsa04015]
Environmental Information Processing; Signal transduction; VEGF signaling pathway [PATH:hsa04370]
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:hsa04151]
Environmental Information Processing; Signaling molecules and interaction; Cytokine-cytokine receptor interaction [PATH:hsa04060]
Cellular Processes; Transport and catabolism; Endocytosis [PATH:hsa04144]
Cellular Processes; Cell communication; Focal adhesion [PATH:hsa04510]
Human Diseases; Cancers; Proteoglycans in cancer [PATH:hsa05205]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
4q11-q12
AA seq 1356 aa AA seqDB search
MQSKVLLAVALWLCVETRAASVGLPSVSLDLPRLSIQKDILTIKANTTLQITCRGQRDLD
WLWPNNQSGSEQRVEVTECSDGLFCKTLTIPKVIGNDTGAYKCFYRETDLASVIYVYVQD
YRSPFIASVSDQHGVVYITENKNKTVVIPCLGSISNLNVSLCARYPEKRFVPDGNRISWD
SKKGFTIPSYMISYAGMVFCEAKINDESYQSIMYIVVVVGYRIYDVVLSPSHGIELSVGE
KLVLNCTARTELNVGIDFNWEYPSSKHQHKKLVNRDLKTQSGSEMKKFLSTLTIDGVTRS
DQGLYTCAASSGLMTKKNSTFVRVHEKPFVAFGSGMESLVEATVGERVRIPAKYLGYPPP
EIKWYKNGIPLESNHTIKAGHVLTIMEVSERDTGNYTVILTNPISKEKQSHVVSLVVYVP
PQIGEKSLISPVDSYQYGTTQTLTCTVYAIPPPHHIHWYWQLEEECANEPSQAVSVTNPY
PCEEWRSVEDFQGGNKIEVNKNQFALIEGKNKTVSTLVIQAANVSALYKCEAVNKVGRGE
RVISFHVTRGPEITLQPDMQPTEQESVSLWCTADRSTFENLTWYKLGPQPLPIHVGELPT
PVCKNLDTLWKLNATMFSNSTNDILIMELKNASLQDQGDYVCLAQDRKTKKRHCVVRQLT
VLERVAPTITGNLENQTTSIGESIEVSCTASGNPPPQIMWFKDNETLVEDSGIVLKDGNR
NLTIRRVRKEDEGLYTCQACSVLGCAKVEAFFIIEGAQEKTNLEIIILVGTAVIAMFFWL
LLVIILRTVKRANGGELKTGYLSIVMDPDELPLDEHCERLPYDASKWEFPRDRLKLGKPL
GRGAFGQVIEADAFGIDKTATCRTVAVKMLKEGATHSEHRALMSELKILIHIGHHLNVVN
LLGACTKPGGPLMVIVEFCKFGNLSTYLRSKRNEFVPYKTKGARFRQGKDYVGAIPVDLK
RRLDSITSSQSSASSGFVEEKSLSDVEEEEAPEDLYKDFLTLEHLICYSFQVAKGMEFLA
SRKCIHRDLAARNILLSEKNVVKICDFGLARDIYKDPDYVRKGDARLPLKWMAPETIFDR
VYTIQSDVWSFGVLLWEIFSLGASPYPGVKIDEEFCRRLKEGTRMRAPDYTTPEMYQTML
DCWHGEPSQRPTFSELVEHLGNLLQANAQQDGKDYIVLPISETLSMEEDSGLSLPTSPVS
CMEEEEVCDPKFHYDNTAGISQYLQNSKRKSRPVSVKTFEDIPLEEPEVKVIPDDNQTDS
GMVLASEELKTLEDRTKLSPSFGGMVPSKSRESVASEGSNQTSGYQSGYHSDDTDTTVYS
SEEAELLKLIEIGVQTGSTAQILQPDSGTTLSSPPV
NT seq 4071 nt NT seq  +upstreamnt  +downstreamnt
atgcagagcaaggtgctgctggccgtcgccctgtggctctgcgtggagacccgggccgcc
tctgtgggtttgcctagtgtttctcttgatctgcccaggctcagcatacaaaaagacata
cttacaattaaggctaatacaactcttcaaattacttgcaggggacagagggacttggac
tggctttggcccaataatcagagtggcagtgagcaaagggtggaggtgactgagtgcagc
gatggcctcttctgtaagacactcacaattccaaaagtgatcggaaatgacactggagcc
tacaagtgcttctaccgggaaactgacttggcctcggtcatttatgtctatgttcaagat
tacagatctccatttattgcttctgttagtgaccaacatggagtcgtgtacattactgag
aacaaaaacaaaactgtggtgattccatgtctcgggtccatttcaaatctcaacgtgtca
ctttgtgcaagatacccagaaaagagatttgttcctgatggtaacagaatttcctgggac
agcaagaagggctttactattcccagctacatgatcagctatgctggcatggtcttctgt
gaagcaaaaattaatgatgaaagttaccagtctattatgtacatagttgtcgttgtaggg
tataggatttatgatgtggttctgagtccgtctcatggaattgaactatctgttggagaa
aagcttgtcttaaattgtacagcaagaactgaactaaatgtggggattgacttcaactgg
gaatacccttcttcgaagcatcagcataagaaacttgtaaaccgagacctaaaaacccag
tctgggagtgagatgaagaaatttttgagcaccttaactatagatggtgtaacccggagt
gaccaaggattgtacacctgtgcagcatccagtgggctgatgaccaagaagaacagcaca
tttgtcagggtccatgaaaaaccttttgttgcttttggaagtggcatggaatctctggtg
gaagccacggtgggggagcgtgtcagaatccctgcgaagtaccttggttacccaccccca
gaaataaaatggtataaaaatggaataccccttgagtccaatcacacaattaaagcgggg
catgtactgacgattatggaagtgagtgaaagagacacaggaaattacactgtcatcctt
accaatcccatttcaaaggagaagcagagccatgtggtctctctggttgtgtatgtccca
ccccagattggtgagaaatctctaatctctcctgtggattcctaccagtacggcaccact
caaacgctgacatgtacggtctatgccattcctcccccgcatcacatccactggtattgg
cagttggaggaagagtgcgccaacgagcccagccaagctgtctcagtgacaaacccatac
ccttgtgaagaatggagaagtgtggaggacttccagggaggaaataaaattgaagttaat
aaaaatcaatttgctctaattgaaggaaaaaacaaaactgtaagtacccttgttatccaa
gcggcaaatgtgtcagctttgtacaaatgtgaagcggtcaacaaagtcgggagaggagag
agggtgatctccttccacgtgaccaggggtcctgaaattactttgcaacctgacatgcag
cccactgagcaggagagcgtgtctttgtggtgcactgcagacagatctacgtttgagaac
ctcacatggtacaagcttggcccacagcctctgccaatccatgtgggagagttgcccaca
cctgtttgcaagaacttggatactctttggaaattgaatgccaccatgttctctaatagc
acaaatgacattttgatcatggagcttaagaatgcatccttgcaggaccaaggagactat
gtctgccttgctcaagacaggaagaccaagaaaagacattgcgtggtcaggcagctcaca
gtcctagagcgtgtggcacccacgatcacaggaaacctggagaatcagacgacaagtatt
ggggaaagcatcgaagtctcatgcacggcatctgggaatccccctccacagatcatgtgg
tttaaagataatgagacccttgtagaagactcaggcattgtattgaaggatgggaaccgg
aacctcactatccgcagagtgaggaaggaggacgaaggcctctacacctgccaggcatgc
agtgttcttggctgtgcaaaagtggaggcatttttcataatagaaggtgcccaggaaaag
acgaacttggaaatcattattctagtaggcacggcggtgattgccatgttcttctggcta
cttcttgtcatcatcctacggaccgttaagcgggccaatggaggggaactgaagacaggc
tacttgtccatcgtcatggatccagatgaactcccattggatgaacattgtgaacgactg
ccttatgatgccagcaaatgggaattccccagagaccggctgaagctaggtaagcctctt
ggccgtggtgcctttggccaagtgattgaagcagatgcctttggaattgacaagacagca
acttgcaggacagtagcagtcaaaatgttgaaagaaggagcaacacacagtgagcatcga
gctctcatgtctgaactcaagatcctcattcatattggtcaccatctcaatgtggtcaac
cttctaggtgcctgtaccaagccaggagggccactcatggtgattgtggaattctgcaaa
tttggaaacctgtccacttacctgaggagcaagagaaatgaatttgtcccctacaagacc
aaaggggcacgattccgtcaagggaaagactacgttggagcaatccctgtggatctgaaa
cggcgcttggacagcatcaccagtagccagagctcagccagctctggatttgtggaggag
aagtccctcagtgatgtagaagaagaggaagctcctgaagatctgtataaggacttcctg
accttggagcatctcatctgttacagcttccaagtggctaagggcatggagttcttggca
tcgcgaaagtgtatccacagggacctggcggcacgaaatatcctcttatcggagaagaac
gtggttaaaatctgtgactttggcttggcccgggatatttataaagatccagattatgtc
agaaaaggagatgctcgcctccctttgaaatggatggccccagaaacaatttttgacaga
gtgtacacaatccagagtgacgtctggtcttttggtgttttgctgtgggaaatattttcc
ttaggtgcttctccatatcctggggtaaagattgatgaagaattttgtaggcgattgaaa
gaaggaactagaatgagggcccctgattatactacaccagaaatgtaccagaccatgctg
gactgctggcacggggagcccagtcagagacccacgttttcagagttggtggaacatttg
ggaaatctcttgcaagctaatgctcagcaggatggcaaagactacattgttcttccgata
tcagagactttgagcatggaagaggattctggactctctctgcctacctcacctgtttcc
tgtatggaggaggaggaagtatgtgaccccaaattccattatgacaacacagcaggaatc
agtcagtatctgcagaacagtaagcgaaagagccggcctgtgagtgtaaaaacatttgaa
gatatcccgttagaagaaccagaagtaaaagtaatcccagatgacaaccagacggacagt
ggtatggttcttgcctcagaagagctgaaaactttggaagacagaaccaaattatctcca
tcttttggtggaatggtgcccagcaaaagcagggagtctgtggcatctgaaggctcaaac
cagacaagcggctaccagtccggatatcactccgatgacacagacaccaccgtgtactcc
agtgaggaagcagaacttttaaagctgatagagattggagtgcaaaccggtagcacagcc
cagattctccagcctgactcggggaccacactgagctctcctcctgtttaa

DBGET integrated database retrieval system