KEGG   Homo sapiens (human): 38Help
Entry
38                CDS       T01001                                 

Gene name
ACAT1, ACAT, MAT, T2, THIL
Definition
acetyl-CoA acetyltransferase 1 (EC:2.3.1.9)
Orthology
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
hsa  Homo sapiens (human)
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Carbon metabolism
Fatty acid metabolism
Module
C5 isoprenoid biosynthesis, mevalonate pathway
Disease
H01076  
Alpha-methylacetoacetic aciduria
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    38 (ACAT1)
   01212 Fatty acid metabolism
    38 (ACAT1)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    38 (ACAT1)
   00630 Glyoxylate and dicarboxylate metabolism
    38 (ACAT1)
   00640 Propanoate metabolism
    38 (ACAT1)
   00650 Butanoate metabolism
    38 (ACAT1)
  Lipid metabolism
   00071 Fatty acid degradation
    38 (ACAT1)
   00072 Synthesis and degradation of ketone bodies
    38 (ACAT1)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    38 (ACAT1)
   00310 Lysine degradation
    38 (ACAT1)
   00380 Tryptophan metabolism
    38 (ACAT1)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    38 (ACAT1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     38 (ACAT1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   38 (ACAT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
11q22.3
AA seq 427 aa AA seqDB search
MAVLAALLRSGARSRSPLLRRLVQEIRYVERSYVSKPTLKEVVIVSATRTPIGSFLGSLS
LLPATKLGSIAIQGAIEKAGIPKEEVKEAYMGNVLQGGEGQAPTRQAVLGAGLPISTPCT
TINKVCASGMKAIMMASQSLMCGHQDVMVAGGMESMSNVPYVMNRGSTPYGGVKLEDLIV
KDGLTDVYNKIHMGSCAENTAKKLNIARNEQDAYAINSYTRSKAAWEAGKFGNEVIPVTV
TVKGQPDVVVKEDEEYKRVDFSKVPKLKTVFQKENGTVTAANASTLNDGAAALVLMTADA
AKRLNVTPLARIVAFADAAVEPIDFPIAPVYAASMVLKDVGLKKEDIAMWEVNEAFSLVV
LANIKMLEIDPQKVNINGGAVSLGHPIGMSGARIVGHLTHALKQGEYGLASICNGGGGAS
AMLIQKL
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atggctgtgctggcggcacttctgcgcagcggcgcccgcagccgcagccccctgctccgg
aggctggtgcaggaaataagatatgtggaacggagttatgtatcaaaacccactttgaag
gaagtggtcatagtaagtgctacaagaacacccattggatcttttttaggcagcctttcc
ttgctgccagccactaagcttggttccattgcaattcagggagccattgaaaaggcaggg
attccaaaagaagaagtgaaagaagcatacatgggtaatgttctacaaggaggtgaagga
caagctcctacaaggcaggcagtattgggtgcaggcttacctatttctactccatgtacc
accataaacaaagtttgtgcttcaggaatgaaagccatcatgatggcctctcaaagtctt
atgtgtggacatcaggatgtgatggtggcaggtgggatggagagcatgtccaatgttcca
tatgtaatgaacagaggatcaacaccatatggtggggtaaagcttgaagatttgattgta
aaagacgggctaactgatgtctacaataaaattcatatgggcagctgtgctgagaataca
gcaaagaagctgaatattgcacgaaatgaacaggacgcttatgctattaattcttatacc
agaagtaaagcagcatgggaagctgggaaatttggaaatgaagttattcctgtcacagtt
acagtaaaaggtcaaccagatgtagtggtgaaagaagatgaagaatataaacgtgttgat
tttagcaaagttccaaagctgaagacagttttccagaaagaaaatggcacagtaacagct
gccaatgccagtacactgaatgatggagcagctgctctggttctcatgacggcagatgca
gcgaagaggctcaatgttacaccactggcaagaatagtagcatttgctgacgctgctgta
gaacctattgattttccaattgctcctgtatatgctgcatctatggttcttaaagatgtg
ggattgaaaaaagaagatattgcaatgtgggaagtaaatgaagcctttagtctggttgta
ctagcaaacattaaaatgttggagattgatccccaaaaagtgaatatcaatggaggagct
gtttctctgggacatccaattgggatgtctggagccaggattgttggtcatttgactcat
gccttgaagcaaggagaatacggtcttgccagtatttgcaatggaggaggaggtgcttct
gccatgctaattcagaagctgtag

DBGET integrated database retrieval system