KEGG   Homo sapiens (human): 38Help
Entry
38                CDS       T01001                                 

Gene name
ACAT1, ACAT, MAT, T2, THIL
Definition
acetyl-CoA acetyltransferase 1 (EC:2.3.1.9)
Orthology
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
hsa  Homo sapiens (human)
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Carbon metabolism
Fatty acid metabolism
Module
C5 isoprenoid biosynthesis, mevalonate pathway
Disease
H01076  
Alpha-methylacetoacetic aciduria
Class
Metabolism; Overview; Carbon metabolism [PATH:hsa01200]
Metabolism; Overview; Fatty acid metabolism [PATH:hsa01212]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:hsa00620]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:hsa00630]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:hsa00640]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:hsa00650]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:hsa00071]
Metabolism; Lipid metabolism; Synthesis and degradation of ketone bodies [PATH:hsa00072]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine degradation [PATH:hsa00280]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:hsa00310]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:hsa00380]
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:hsa00900]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
11q22.3
AA seq 427 aa AA seqDB search
MAVLAALLRSGARSRSPLLRRLVQEIRYVERSYVSKPTLKEVVIVSATRTPIGSFLGSLS
LLPATKLGSIAIQGAIEKAGIPKEEVKEAYMGNVLQGGEGQAPTRQAVLGAGLPISTPCT
TINKVCASGMKAIMMASQSLMCGHQDVMVAGGMESMSNVPYVMNRGSTPYGGVKLEDLIV
KDGLTDVYNKIHMGSCAENTAKKLNIARNEQDAYAINSYTRSKAAWEAGKFGNEVIPVTV
TVKGQPDVVVKEDEEYKRVDFSKVPKLKTVFQKENGTVTAANASTLNDGAAALVLMTADA
AKRLNVTPLARIVAFADAAVEPIDFPIAPVYAASMVLKDVGLKKEDIAMWEVNEAFSLVV
LANIKMLEIDPQKVNINGGAVSLGHPIGMSGARIVGHLTHALKQGEYGLASICNGGGGAS
AMLIQKL
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atggctgtgctggcggcacttctgcgcagcggcgcccgcagccgcagccccctgctccgg
aggctggtgcaggaaataagatatgtggaacggagttatgtatcaaaacccactttgaag
gaagtggtcatagtaagtgctacaagaacacccattggatcttttttaggcagcctttcc
ttgctgccagccactaagcttggttccattgcaattcagggagccattgaaaaggcaggg
attccaaaagaagaagtgaaagaagcatacatgggtaatgttctacaaggaggtgaagga
caagctcctacaaggcaggcagtattgggtgcaggcttacctatttctactccatgtacc
accataaacaaagtttgtgcttcaggaatgaaagccatcatgatggcctctcaaagtctt
atgtgtggacatcaggatgtgatggtggcaggtgggatggagagcatgtccaatgttcca
tatgtaatgaacagaggatcaacaccatatggtggggtaaagcttgaagatttgattgta
aaagacgggctaactgatgtctacaataaaattcatatgggcagctgtgctgagaataca
gcaaagaagctgaatattgcacgaaatgaacaggacgcttatgctattaattcttatacc
agaagtaaagcagcatgggaagctgggaaatttggaaatgaagttattcctgtcacagtt
acagtaaaaggtcaaccagatgtagtggtgaaagaagatgaagaatataaacgtgttgat
tttagcaaagttccaaagctgaagacagttttccagaaagaaaatggcacagtaacagct
gccaatgccagtacactgaatgatggagcagctgctctggttctcatgacggcagatgca
gcgaagaggctcaatgttacaccactggcaagaatagtagcatttgctgacgctgctgta
gaacctattgattttccaattgctcctgtatatgctgcatctatggttcttaaagatgtg
ggattgaaaaaagaagatattgcaatgtgggaagtaaatgaagcctttagtctggttgta
ctagcaaacattaaaatgttggagattgatccccaaaaagtgaatatcaatggaggagct
gtttctctgggacatccaattgggatgtctggagccaggattgttggtcatttgactcat
gccttgaagcaaggagaatacggtcttgccagtatttgcaatggaggaggaggtgcttct
gccatgctaattcagaagctgtag

DBGET integrated database retrieval system