KEGG   Homo sapiens (human): 3816Help
Entry
3816              CDS       T01001                                 

Gene name
KLK1, KLKR, Klk6, hK1
Definition
(RefSeq) kallikrein 1 (EC:3.4.21.35)
  KO
K01325  
tissue kallikrein [EC:3.4.21.35]
Organism
hsa  Homo sapiens (human)
Pathway
Renin-angiotensin system
Endocrine and other factor-regulated calcium reabsorption
Drug target
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Endocrine system
   04614 Renin-angiotensin system
    3816 (KLK1)
  Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    3816 (KLK1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.35  tissue kallikrein
     3816 (KLK1)
Peptidases [BR:hsa01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   3816 (KLK1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   3816 (KLK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
19q13.3
AA seq 262 aa AA seqDB search
MWFLVLCLALSLGGTGAAPPIQSRIVGGWECEQHSQPWQAALYHFSTFQCGGILVHRQWV
LTAAHCISDNYQLWLGRHNLFDDENTAQFVHVSESFPHPGFNMSLLENHTRQADEDYSHD
LMLLRLTEPADTITDAVKVVELPTEEPEVGSTCLASGWGSIEPENFSFPDDLQCVDLKIL
PNDECKKAHVQKVTDFMLCVGHLEGGKDTCVGDSGGPLMCDGVLQGVTSWGYVPCGTPNK
PSVAVRVLSYVKWIEDTIAENS
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgtggttcctggttctgtgcctcgccctgtccctgggggggactggtgctgcgcccccg
attcagtcccggattgtgggaggctgggagtgtgagcagcattcccagccctggcaggcg
gctctgtaccatttcagcactttccagtgtgggggcatcctggtgcaccgccagtgggtg
ctcacagctgctcattgcatcagcgacaattaccagctctggctgggtcgccacaacttg
tttgacgacgaaaacacagcccagtttgttcatgtcagtgagagcttcccacaccctggc
ttcaacatgagcctcctggagaaccacacccgccaagcagacgaggactacagccacgac
ctcatgctgctccgcctgacagagcctgctgataccatcacagatgctgtgaaggtcgtg
gagttgcccaccgaggaacccgaagtggggagcacctgtttggcttccggctggggcagc
atcgaaccagagaatttctcatttccagatgatctccagtgtgtggacctcaaaatcctg
cctaatgatgagtgcaaaaaagcccacgtccagaaggtgacagacttcatgctgtgtgtc
ggacacctggaaggtggcaaagacacctgtgtgggtgattcagggggcccgctgatgtgt
gatggtgtgctccaaggtgtcacatcatggggctacgtcccttgtggcacccccaataag
ccttctgtcgccgtcagagtgctgtcttatgtgaagtggatcgaggacaccatagcggag
aactcctga

DBGET integrated database retrieval system