KEGG   Homo sapiens (human): 3818Help
Entry
3818              CDS       T01001                                 

Gene name
KLKB1, KLK3, PPK
Definition
kallikrein B, plasma (Fletcher factor) 1 (EC:3.4.21.34)
Orthology
K01324  
plasma kallikrein [EC:3.4.21.34]
Organism
hsa  Homo sapiens (human)
Pathway
Complement and coagulation cascades
Disease
H01078  
Fletcher factor deficiency
Drug target
Aprotinin: 
Ecallantide: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Immune system
   04610 Complement and coagulation cascades
    3818 (KLKB1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.34  plasma kallikrein
     3818 (KLKB1)
Peptidases [BR:hsa01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   3818 (KLKB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
4q35
AA seq 638 aa AA seqDB search
MILFKQATYFISLFATVSCGCLTQLYENAFFRGGDVASMYTPNAQYCQMRCTFHPRCLLF
SFLPASSINDMEKRFGCFLKDSVTGTLPKVHRTGAVSGHSLKQCGHQISACHRDIYKGVD
MRGVNFNVSKVSSVEECQKRCTSNIRCQFFSYATQTFHKAEYRNNCLLKYSPGGTPTAIK
VLSNVESGFSLKPCALSEIGCHMNIFQHLAFSDVDVARVLTPDAFVCRTICTYHPNCLFF
TFYTNVWKIESQRNVCLLKTSESGTPSSSTPQENTISGYSLLTCKRTLPEPCHSKIYPGV
DFGGEELNVTFVKGVNVCQETCTKMIRCQFFTYSLLPEDCKEEKCKCFLRLSMDGSPTRI
AYGTQGSSGYSLRLCNTGDNSVCTTKTSTRIVGGTNSSWGEWPWQVSLQVKLTAQRHLCG
GSLIGHQWVLTAAHCFDGLPLQDVWRIYSGILNLSDITKDTPFSQIKEIIIHQNYKVSEG
NHDIALIKLQAPLNYTEFQKPICLPSKGDTSTIYTNCWVTGWGFSKEKGEIQNILQKVNI
PLVTNEECQKRYQDYKITQRMVCAGYKEGGKDACKGDSGGPLVCKHNGMWRLVGITSWGE
GCARREQPGVYTKVAEYMDWILEKTQSSDGKAQMQSPA
NT seq 1917 nt NT seq  +upstreamnt  +downstreamnt
atgattttattcaagcaagcaacttatttcatttccttgtttgctacagtttcctgtgga
tgtctgactcaactctatgaaaacgccttcttcagaggtggggatgtagcttccatgtac
accccaaatgcccaatactgccagatgaggtgcacattccacccaaggtgtttgctattc
agttttcttccagcaagttcaatcaatgacatggagaaaaggtttggttgcttcttgaaa
gatagtgttacaggaaccctgccaaaagtacatcgaacaggtgcagtttctggacattcc
ttgaagcaatgtggtcatcaaataagtgcttgccatcgagacatttataaaggagttgat
atgagaggagtcaattttaatgtgtctaaggttagcagtgttgaagaatgccaaaaaagg
tgcaccagtaacattcgctgccagtttttttcatatgccacgcaaacatttcacaaggca
gagtaccggaacaattgcctattaaagtacagtcccggaggaacacctaccgctataaag
gtgctgagtaacgtggaatctggattctcactgaagccctgtgccctttcagaaattggt
tgccacatgaacatcttccagcatcttgcgttctcagatgtggatgttgccagggttctc
actccagatgcttttgtgtgtcggaccatctgcacctatcaccccaactgcctcttcttt
acattctatacaaatgtatggaaaatcgagtcacaaagaaatgtttgtcttcttaaaaca
tctgaaagtggcacaccaagttcctctactcctcaagaaaacaccatatctggatatagc
cttttaacctgcaaaagaactttacctgaaccctgccattctaaaatttacccgggagtt
gactttggaggagaagaattgaatgtgacttttgttaaaggagtgaatgtttgccaagag
acttgcacaaagatgattcgctgtcagtttttcacttattctttactcccagaagactgt
aaggaagagaagtgtaagtgtttcttaagattatctatggatggttctccaactaggatt
gcgtatgggacacaagggagctctggttactctttgagattgtgtaacactggggacaac
tctgtctgcacaacaaaaacaagcacacgcattgttggaggaacaaactcttcttgggga
gagtggccctggcaggtgagcctgcaggtgaagctgacagctcagaggcacctgtgtgga
gggtcactcataggacaccagtgggtcctcactgctgcccactgctttgatgggcttccc
ctgcaggatgtttggcgcatctatagtggcattttaaatctgtcagacattacaaaagat
acacctttctcacaaataaaagagattattattcaccaaaactataaagtctcagaaggg
aatcatgatatcgccttgataaaactccaggctcctttgaattacactgaattccaaaaa
ccaatatgcctaccttccaaaggtgacacaagcacaatttataccaactgttgggtaacc
ggatggggcttctcgaaggagaaaggtgaaatccaaaatattctacaaaaggtaaatatt
cctttggtaacaaatgaagaatgccagaaaagatatcaagattataaaataacccaacgg
atggtctgtgctggctataaagaagggggaaaagatgcttgtaagggagattcaggtggt
cccttagtttgcaaacacaatggaatgtggcgtttggtgggcatcaccagctggggtgaa
ggctgtgcccgcagggagcaacctggtgtctacaccaaagtcgctgagtacatggactgg
attttagagaaaacacagagcagtgatggaaaagctcagatgcagtcaccagcatga

DBGET integrated database retrieval system