KEGG   Homo sapiens (human): 3818Help
Entry
3818              CDS       T01001                                 

Gene name
KLKB1, KLK3, PKK, PKKD, PPK
Definition
(RefSeq) kallikrein B1
  KO
K01324  plasma kallikrein [EC:3.4.21.34]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04610  Complement and coagulation cascades
Disease
H01078  Fletcher factor deficiency
Drug target
Ecallantide: D03931
Gabexate (DG01400): D01672 D08004
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Immune system
   04610 Complement and coagulation cascades
    3818 (KLKB1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.34  plasma kallikrein
     3818 (KLKB1)
Peptidases [BR:hsa01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   3818 (KLKB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin PAN_1 PAN_4 Trypsin_2 DUF1986 PAN_2
Motif
Other DBs
NCBI-GeneID: 3818
NCBI-ProteinID: NP_000883
OMIM: 229000
HGNC: 6371
Ensembl: ENSG00000164344
Vega: OTTHUMG00000150347
Pharos: P03952(Tclin)
UniProt: P03952 A8K9A9
Structure
PDB: 

Jmol
Position
4q35.2
AA seq 638 aa AA seqDB search
MILFKQATYFISLFATVSCGCLTQLYENAFFRGGDVASMYTPNAQYCQMRCTFHPRCLLF
SFLPASSINDMEKRFGCFLKDSVTGTLPKVHRTGAVSGHSLKQCGHQISACHRDIYKGVD
MRGVNFNVSKVSSVEECQKRCTSNIRCQFFSYATQTFHKAEYRNNCLLKYSPGGTPTAIK
VLSNVESGFSLKPCALSEIGCHMNIFQHLAFSDVDVARVLTPDAFVCRTICTYHPNCLFF
TFYTNVWKIESQRNVCLLKTSESGTPSSSTPQENTISGYSLLTCKRTLPEPCHSKIYPGV
DFGGEELNVTFVKGVNVCQETCTKMIRCQFFTYSLLPEDCKEEKCKCFLRLSMDGSPTRI
AYGTQGSSGYSLRLCNTGDNSVCTTKTSTRIVGGTNSSWGEWPWQVSLQVKLTAQRHLCG
GSLIGHQWVLTAAHCFDGLPLQDVWRIYSGILNLSDITKDTPFSQIKEIIIHQNYKVSEG
NHDIALIKLQAPLNYTEFQKPICLPSKGDTSTIYTNCWVTGWGFSKEKGEIQNILQKVNI
PLVTNEECQKRYQDYKITQRMVCAGYKEGGKDACKGDSGGPLVCKHNGMWRLVGITSWGE
GCARREQPGVYTKVAEYMDWILEKTQSSDGKAQMQSPA
NT seq 1917 nt NT seq  +upstreamnt  +downstreamnt
atgattttattcaagcaagcaacttatttcatttccttgtttgctacagtttcctgtgga
tgtctgactcaactctatgaaaacgccttcttcagaggtggggatgtagcttccatgtac
accccaaatgcccaatactgccagatgaggtgcacattccacccaaggtgtttgctattc
agttttcttccagcaagttcaatcaatgacatggagaaaaggtttggttgcttcttgaaa
gatagtgttacaggaaccctgccaaaagtacatcgaacaggtgcagtttctggacattcc
ttgaagcaatgtggtcatcaaataagtgcttgccatcgagacatttataaaggagttgat
atgagaggagtcaattttaatgtgtctaaggttagcagtgttgaagaatgccaaaaaagg
tgcaccagtaacattcgctgccagtttttttcatatgccacgcaaacatttcacaaggca
gagtaccggaacaattgcctattaaagtacagtcccggaggaacacctaccgctataaag
gtgctgagtaacgtggaatctggattctcactgaagccctgtgccctttcagaaattggt
tgccacatgaacatcttccagcatcttgcgttctcagatgtggatgttgccagggttctc
actccagatgcttttgtgtgtcggaccatctgcacctatcaccccaactgcctcttcttt
acattctatacaaatgtatggaaaatcgagtcacaaagaaatgtttgtcttcttaaaaca
tctgaaagtggcacaccaagttcctctactcctcaagaaaacaccatatctggatatagc
cttttaacctgcaaaagaactttacctgaaccctgccattctaaaatttacccgggagtt
gactttggaggagaagaattgaatgtgacttttgttaaaggagtgaatgtttgccaagag
acttgcacaaagatgattcgctgtcagtttttcacttattctttactcccagaagactgt
aaggaagagaagtgtaagtgtttcttaagattatctatggatggttctccaactaggatt
gcgtatgggacacaagggagctctggttactctttgagattgtgtaacactggggacaac
tctgtctgcacaacaaaaacaagcacacgcattgttggaggaacaaactcttcttgggga
gagtggccctggcaggtgagcctgcaggtgaagctgacagctcagaggcacctgtgtgga
gggtcactcataggacaccagtgggtcctcactgctgcccactgctttgatgggcttccc
ctgcaggatgtttggcgcatctatagtggcattttaaatctgtcagacattacaaaagat
acacctttctcacaaataaaagagattattattcaccaaaactataaagtctcagaaggg
aatcatgatatcgccttgataaaactccaggctcctttgaattacactgaattccaaaaa
ccaatatgcctaccttccaaaggtgacacaagcacaatttataccaactgttgggtaacc
ggatggggcttctcgaaggagaaaggtgaaatccaaaatattctacaaaaggtaaatatt
cctttggtaacaaatgaagaatgccagaaaagatatcaagattataaaataacccaacgg
atggtctgtgctggctataaagaagggggaaaagatgcttgtaagggagattcaggtggt
cccttagtttgcaaacacaatggaatgtggcgtttggtgggcatcaccagctggggtgaa
ggctgtgcccgcagggagcaacctggtgtctacaccaaagtcgctgagtacatggactgg
attttagagaaaacacagagcagtgatggaaaagctcagatgcagtcaccagcatga

DBGET integrated database retrieval system