KEGG   Homo sapiens (human): 387Help
Entry
387               CDS       T01001                                 

Gene name
RHOA, ARH12, ARHA, RHO12, RHOH12
Definition
ras homolog family member A
Orthology
K04513  
Ras homolog gene family, member A
Organism
hsa  Homo sapiens (human)
Pathway
Ras signaling pathway
Rap1 signaling pathway
cGMP-PKG signaling pathway
cAMP signaling pathway
Chemokine signaling pathway
Endocytosis
Vascular smooth muscle contraction
Wnt signaling pathway
TGF-beta signaling pathway
Axon guidance
Focal adhesion
Adherens junction
Tight junction
Platelet activation
T cell receptor signaling pathway
Leukocyte transendothelial migration
Neurotrophin signaling pathway
Regulation of actin cytoskeleton
Oxytocin signaling pathway
Pancreatic secretion
Bacterial invasion of epithelial cells
Pathogenic Escherichia coli infection
Pertussis
Tuberculosis
Pathways in cancer
Viral carcinogenesis
Proteoglycans in cancer
MicroRNAs in cancer
Colorectal cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    387 (RHOA)
   04015 Rap1 signaling pathway
    387 (RHOA)
   04310 Wnt signaling pathway
    387 (RHOA)
   04350 TGF-beta signaling pathway
    387 (RHOA)
   04024 cAMP signaling pathway
    387 (RHOA)
   04022 cGMP - PKG signaling pathway
    387 (RHOA)
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    387 (RHOA)
  Cell motility
   04810 Regulation of actin cytoskeleton
    387 (RHOA)
  Cellular commiunity
   04510 Focal adhesion
    387 (RHOA)
   04520 Adherens junction
    387 (RHOA)
   04530 Tight junction
    387 (RHOA)
 Organismal Systems
  Immune system
   04611 Platelet activation
    387 (RHOA)
   04660 T cell receptor signaling pathway
    387 (RHOA)
   04670 Leukocyte transendothelial migration
    387 (RHOA)
   04062 Chemokine signaling pathway
    387 (RHOA)
  Endocrine system
   04921 Oxytocin signaling pathway
    387 (RHOA)
  Circulatory system
   04270 Vascular smooth muscle contraction
    387 (RHOA)
  Digestive system
   04972 Pancreatic secretion
    387 (RHOA)
  Nervous system
   04722 Neurotrophin signaling pathway
    387 (RHOA)
  Development
   04360 Axon guidance
    387 (RHOA)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    387 (RHOA)
   05206 MicroRNAs in cancer
    387 (RHOA)
   05205 Proteoglycans in cancer
    387 (RHOA)
   05203 Viral carcinogenesis
    387 (RHOA)
   05210 Colorectal cancer
    387 (RHOA)
  Infectious diseases
   05130 Pathogenic Escherichia coli infection
    387 (RHOA)
   05133 Pertussis
    387 (RHOA)
   05152 Tuberculosis
    387 (RHOA)
   05100 Bacterial invasion of epithelial cells
    387 (RHOA)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   387 (RHOA)
  Exosomal proteins of other body fluids (saliva and urine)
   387 (RHOA)
  Exosomal proteins of colorectal cancer cells
   387 (RHOA)
  Exosomal proteins of bladder cancer cells
   387 (RHOA)
GTP-binding proteins [BR:hsa04031]
 Small (Monomeric) G-proteins
  Rho Family
   RhoA/B/C [OT]
    387 (RHOA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
3p21.3
AA seq 193 aa AA seqDB search
MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDT
AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD
LRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ
ARRGKKKSGCLVL
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atggctgccatccggaagaaactggtgattgttggtgatggagcctgtggaaagacatgc
ttgctcatagtcttcagcaaggaccagttcccagaggtgtatgtgcccacagtgtttgag
aactatgtggcagatatcgaggtggatggaaagcaggtagagttggctttgtgggacaca
gctgggcaggaagattatgatcgcctgaggcccctctcctacccagataccgatgttata
ctgatgtgtttttccatcgacagccctgatagtttagaaaacatcccagaaaagtggacc
ccagaagtcaagcatttctgtcccaacgtgcccatcatcctggttgggaataagaaggat
cttcggaatgatgagcacacaaggcgggagctagccaagatgaagcaggagccggtgaaa
cctgaagaaggcagagatatggcaaacaggattggcgcttttgggtacatggagtgttca
gcaaagaccaaagatggagtgagagaggtttttgaaatggctacgagagctgctctgcaa
gctagacgtgggaagaaaaaatctgggtgccttgtcttgtga

DBGET integrated database retrieval system