KEGG   Homo sapiens (human): 387893Help
Entry
387893            CDS       T01001                                 

Gene name
SETD8, KMT5A, PR-Set7, SET07, SET8
Definition
SET domain containing (lysine methyltransferase) 8 (EC:2.1.1.43)
Orthology
K11428  
histone-lysine N-methyltransferase SETD8 [EC:2.1.1.43]
Organism
hsa  Homo sapiens (human)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    387893 (SETD8)
Enzymes [BR:hsa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     387893 (SETD8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
12q24.31
AA seq 352 aa AA seqDB search
MARGRKMSKPRAVEAAAAAAAVAATAPGPEMVERRGPGRPRTDGENVFTGQSKIYSYMSP
NKCSGMRFPLQEENSVTHHEVKCQGKPLAGIYRKREEKRNAGNAVRSAMKSEEQKIKDAR
KGPLVPFPNQKSEAAEPPKTPPSSCDSTNAAIAKQALKKPIKGKQAPRKKAQGKTQQNRK
LTDFYPVRRSSRKSKAELQSEERKRIDELIESGKEEGMKIDLIDGKGRGVIATKQFSRGD
FVVEYHGDLIEITDAKKREALYAQDPSTGCYMYYFQYLSKTYCVDATRETNRLGRLINHS
KCGNCQTKLHDIDGVPHLILIASRDIAAGEELLYDYGDRSKASIEAHPWLKH
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atggctagaggcaggaagatgtccaagccccgcgcggtggaggcggcggcggcggcggcg
gcggtggcagcgacggccccgggcccggagatggtggagcggaggggcccggggaggccc
cgcaccgacggggagaacgtatttaccgggcagtcaaagatctattcctacatgagcccg
aacaaatgctctggaatgcgtttcccccttcaggaagagaactcagttacacatcacgaa
gtcaaatgccaggggaaaccattagccggaatctacaggaaacgagaagagaaaagaaat
gctgggaacgcagtacggagcgccatgaagtccgaggaacagaagatcaaagacgccagg
aaaggtcccctggtaccttttccaaaccaaaaatctgaagcagcagaacctccaaaaact
ccaccctcatcttgtgattccaccaatgcagccatcgccaagcaagccctgaaaaagccc
atcaagggcaaacaggccccccgaaaaaaagctcaaggaaaaacgcaacagaatcgcaaa
cttacggatttctaccctgtccgaaggagctccaggaagagcaaagccgagctgcagtct
gaagaaaggaaaagaatagatgaattgattgaaagtgggaaggaagaaggaatgaagatt
gacctcatcgatggcaaaggcaggggtgtgattgccaccaagcagttctcccggggtgac
tttgtggtggaataccacggggacctcatcgagatcaccgacgccaagaaacgggaggct
ctgtacgcacaggacccttccacgggctgctacatgtactattttcagtatctgagcaaa
acctactgcgtggatgcaactagagagacaaatcgcctaggaagactgatcaatcacagc
aaatgtgggaactgccaaaccaaactgcacgacatcgacggcgtacctcacctcatcctc
atcgcctcccgagacatcgcggctggggaggagctcctgtatgactatggggaccgcagc
aaggcttccattgaagcccacccgtggctgaagcattaa

DBGET integrated database retrieval system