KEGG   Homo sapiens (human): 39Help
Entry
39                CDS       T01001                                 

Gene name
ACAT2
Definition
acetyl-CoA acetyltransferase 2 (EC:2.3.1.9)
Orthology
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
hsa  Homo sapiens (human)
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Carbon metabolism
Fatty acid metabolism
Fat digestion and absorption
Module
C5 isoprenoid biosynthesis, mevalonate pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    39 (ACAT2)
   01212 Fatty acid metabolism
    39 (ACAT2)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    39 (ACAT2)
   00630 Glyoxylate and dicarboxylate metabolism
    39 (ACAT2)
   00640 Propanoate metabolism
    39 (ACAT2)
   00650 Butanoate metabolism
    39 (ACAT2)
  Lipid metabolism
   00071 Fatty acid degradation
    39 (ACAT2)
   00072 Synthesis and degradation of ketone bodies
    39 (ACAT2)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    39 (ACAT2)
   00310 Lysine degradation
    39 (ACAT2)
   00380 Tryptophan metabolism
    39 (ACAT2)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    39 (ACAT2)
 Organismal Systems
  Digestive system
   04975 Fat digestion and absorption
    39 (ACAT2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     39 (ACAT2)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   39 (ACAT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
UniProt: 
Structure
PDB: 

Jmol
Position
6q25.3
AA seq 397 aa AA seqDB search
MNAGSDPVVIVSAARTIIGSFNGALAAVPVQDLGSTVIKEVLKRATVAPEDVSEVIFGHV
LAAGCGQNPVRQASVGAGIPYSVPAWSCQMICGSGLKAVCLAVQSIGIGDSSIVVAGGME
NMSKAPHLAYLRTGVKIGEMPLTDSILCDGLTDAFHNCHMGITAENVAKKWQVSREDQDK
VAVLSQNRTENAQKAGHFDKEIVPVLVSTRKGLIEVKTDEFPRHGSNIEAMSKLKPYFLT
DGTGTVTPANASGINDGAAAVVLMKKSEADKRGLTPLARIVSWSQVGVEPSIMGIGPIPA
IKQAVTKAGWSLEDVDIFEINEAFAAVSAAIVKELGLNPEKVNIEGGAIALGHPLGASGC
RILVTLLHTLERMGRSRGVAALCIGGGMGIAMCVQRE
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcaggctcagatcctgtggtcatcgtctcggcggcgcggaccatcataggttcc
ttcaatggtgccttagctgctgttcctgtccaggacctgggctccactgtcatcaaagaa
gtcttgaagagggccactgtggctccggaagatgtgtctgaggtcatctttggacatgtc
ttggcagcaggctgtgggcagaatcctgttagacaagccagtgtgggtgcaggaattccc
tactctgttccagcatggagctgccagatgatctgtgggtcaggcctaaaagctgtgtgc
cttgcagtccagtcaatagggataggagactccagcattgtggttgcaggaggcatggaa
aatatgagcaaggctcctcacttggcttacttgagaacaggagtaaagataggtgagatg
ccactgactgacagtatactctgtgatggtcttacagatgcatttcacaactgtcatatg
ggtattacagctgaaaatgtagccaaaaaatggcaagtgagtagagaagatcaggacaag
gttgcagttctgtcccagaacaggacagagaatgcacagaaagctggccattttgacaaa
gagattgtaccagttttggtgtcaactagaaaaggtcttattgaagttaaaacagatgag
tttcctcgccatgggagcaacatagaagccatgtccaagctaaagccttactttcttact
gatggaacgggaacagtcaccccagccaatgcttcaggaataaatgatggtgctgcagct
gtcgttcttatgaagaagtcagaagctgataaacgtgggcttacacctttagcacggata
gtttcctggtcccaagtgggtgtggagccttccattatgggaataggaccaattccagcc
ataaagcaagctgttacaaaagcaggttggtcactggaagatgttgacatatttgaaatc
aatgaagcctttgcagctgtctctgctgcaatagttaaagaacttggattaaacccagag
aaggtcaatattgaaggaggggctatagccttgggccaccctcttggagcatctggctgt
cgaattcttgtgaccctgttacacacactggagagaatgggcagaagtcgtggtgttgca
gccctgtgcattgggggtgggatgggaatagcaatgtgtgttcagagagaatga

  All links  
No link information was found.   
DBGET integrated database retrieval system