KEGG   Homo sapiens (human): 3908Help
Entry
3908              CDS       T01001                                 

Gene name
LAMA2, LAMM
Definition
laminin, alpha 2
Orthology
K05637  
laminin, alpha 1/2
Organism
hsa  Homo sapiens (human)
Pathway
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Toxoplasmosis
Amoebiasis
Pathways in cancer
Small cell lung cancer
Hypertrophic cardiomyopathy (HCM)
Arrhythmogenic right ventricular cardiomyopathy (ARVC)
Dilated cardiomyopathy
Viral myocarditis
Disease
H00590  
Congenital muscular dystrophies (CMD/MDC)
Class
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:hsa04151]
Environmental Information Processing; Signaling molecules and interaction; ECM-receptor interaction [PATH:hsa04512]
Cellular Processes; Cell communication; Focal adhesion [PATH:hsa04510]
Human Diseases; Cancers; Pathways in cancer [PATH:hsa05200]
Human Diseases; Cancers; Small cell lung cancer [PATH:hsa05222]
Human Diseases; Cardiovascular diseases; Hypertrophic cardiomyopathy (HCM) [PATH:hsa05410]
Human Diseases; Cardiovascular diseases; Arrhythmogenic right ventricular cardiomyopathy (ARVC) [PATH:hsa05412]
Human Diseases; Cardiovascular diseases; Dilated cardiomyopathy (DCM) [PATH:hsa05414]
Human Diseases; Cardiovascular diseases; Viral myocarditis [PATH:hsa05416]
Human Diseases; Infectious diseases; Amoebiasis [PATH:hsa05146]
Human Diseases; Infectious diseases; Toxoplasmosis [PATH:hsa05145]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
6q22-q23
AA seq 3122 aa AA seqDB search
MPGAAGVLLLLLLSGGLGGVQAQRPQQQRQSQAHQQRGLFPAVLNLASNALITTNATCGE
KGPEMYCKLVEHVPGQPVRNPQCRICNQNSSNPNQRHPITNAIDGKNTWWQSPSIKNGIE
YHYVTITLDLQQVFQIAYVIVKAANSPRPGNWILERSLDDVEYKPWQYHAVTDTECLTLY
NIYPRTGPPSYAKDDEVICTSFYSKIHPLENGEIHISLINGRPSADDPSPELLEFTSARY
IRLRFQRIRTLNADLMMFAHKDPREIDPIVTRRYYYSVKDISVGGMCICYGHARACPLDP
ATNKSRCECEHNTCGDSCDQCCPGFHQKPWRAGTFLTKTECEACNCHGKAEECYYDENVA
RRNLSLNIRGKYIGGGVCINCTQNTAGINCETCTDGFFRPKGVSPNYPRPCQPCHCDPIG
SLNEVCVKDEKHARRGLAPGSCHCKTGFGGVSCDRCARGYTGYPDCKACNCSGLGSKNED
PCFGPCICKENVEGGDCSRCKSGFFNLQEDNWKGCDECFCSGVSNRCQSSYWTYGKIQDM
SGWYLTDLPGRIRVAPQQDDLDSPQQISISNAEARQALPHSYYWSAPAPYLGNKLPAVGG
QLTFTISYDLEEEEEDTERVLQLMIILEGNDLSISTAQDEVYLHPSEEHTNVLLLKEESF
TIHGTHFPVRRKEFMTVLANLKRVLLQITYSFGMDAIFRLSSVNLESAVSYPTDGSIAAA
VEVCQCPPGYTGSSCESCWPRHRRVNGTIFGGICEPCQCFGHAESCDDVTGECLNCKDHT
GGPYCDKCLPGFYGEPTKGTSEDCQPCACPLNIPSNNFSPTCHLDRSLGLICDGCPVGYT
GPRCERCAEGYFGQPSVPGGSCQPCQCNDNLDFSIPGSCDSLSGSCLICKPGTTGRYCEL
CADGYFGDAVDAKNCQPCRCNAGGSFSEVCHSQTGQCECRANVQGQRCDKCKAGTFGLQS
ARGCVPCNCNSFGSKSFDCEESGQCWCQPGVTGKKCDRCAHGYFNFQEGGCTACECSHLG
NNCDPKTGRCICPPNTIGEKCSKCAPNTWGHSITTGCKACNCSTVGSLDFQCNVNTGQCN
CHPKFSGAKCTECSRGHWNYPRCNLCDCFLPGTDATTCDSETKKCSCSDQTGQCTCKVNV
EGIHCDRCRPGKFGLDAKNPLGCSSCYCFGTTTQCSEAKGLIRTWVTLKAEQTILPLVDE
ALQHTTTKGIVFQHPEIVAHMDLMREDLHLEPFYWKLPEQFEGKKLMAYGGKLKYAIYFE
AREETGFSTYNPQVIIRGGTPTHARIIVRHMAAPLIGQLTRHEIEMTEKEWKYYGDDPRV
HRTVTREDFLDILYDIHYILIKATYGNFMRQSRISEISMEVAEQGRGTTMTPPADLIEKC
DCPLGYSGLSCEACLPGFYRLRSQPGGRTPGPTLGTCVPCQCNGHSSLCDPETSICQNCQ
HHTAGDFCERCALGYYGIVKGLPNDCQQCACPLISSSNNFSPSCVAEGLDDYRCTACPRG
YEGQYCERCAPGYTGSPGNPGGSCQECECDPYGSLPVPCDPVTGFCTCRPGATGRKCDGC
KHWHAREGWECVFCGDECTGLLLGDLARLEQMVMSINLTGPLPAPYKMLYGLENMTQELK
HLLSPQRAPERLIQLAEGNLNTLVTEMNELLTRATKVTADGEQTGQDAERTNTRAKSLGE
FIKELARDAEAVNEKAIKLNETLGTRDEAFERNLEGLQKEIDQMIKELRRKNLETQKEIA
EDELVAAEALLKKVKKLFGESRGENEEMEKDLREKLADYKNKVDDAWDLLREATDKIREA
NRLFAVNQKNMTALEKKKEAVESGKRQIENTLKEGNDILDEANRLADEINSIIDYVEDIQ
TKLPPMSEELNDKIDDLSQEIKDRKLAEKVSQAESHAAQLNDSSAVLDGILDEAKNISFN
ATAAFKAYSNIKDYIDEAEKVAKEAKDLAHEATKLATGPRGLLKEDAKGCLQKSFRILNE
AKKLANDVKENEDHLNGLKTRIENADARNGDLLRTLNDTLGKLSAIPNDTAAKLQAVKDK
ARQANDTAKDVLAQITELHQNLDGLKKNYNKLADSVAKTNAVVKDPSKNKIIADADATVK
NLEQEADRLIDKLKPIKELEDNLKKNISEIKELINQARKQANSIKVSVSSGGDCIRTYKP
EIKKGSYNNIVVNVKTAVADNLLFYLGSAKFIDFLAIEMRKGKVSFLWDVGSGVGRVEYP
DLTIDDSYWYRIVASRTGRNGTISVRALDGPKASIVPSTHHSTSPPGYTILDVDANAMLF
VGGLTGKLKKADAVRVITFTGCMGETYFDNKPIGLWNFREKEGDCKGCTVSPQVEDSEGT
IQFDGEGYALVSRPIRWYPNISTVMFKFRTFSSSALLMYLATRDLRDFMSVELTDGHIKV
SYDLGSGMASVVSNQNHNDGKWKSFTLSRIQKQANISIVDIDTNQEENIATSSSGNNFGL
DLKADDKIYFGGLPTLRNLSMKARPEVNLKKYSGCLKDIEISRTPYNILSSPDYVGVTKG
CSLENVYTVSFPKPGFVELSPVPIDVGTEINLSFSTKNESGIILLGSGGTPAPPRRKRRQ
TGQAYYVILLNRGRLEVHLSTGARTMRKIVIRPEPNLFHDGREHSVHVERTRGIFTVQVD
ENRRYMQNLTVEQPIEVKKLFVGGAPPEFQPSPLRNIPPFEGCIWNLVINSVPMDFARPV
SFKNADIGRCAHQKLREDEDGAAPAEIVIQPEPVPTPAFPTPTPVLTHGPCAAESEPALL
IGSKQFGLSRNSHIAIAFDDTKVKNRLTIELEVRTEAESGLLFYMARINHADFATVQLRN
GLPYFSYDLGSGDTHTMIPTKINDGQWHKIKIMRSKQEGILYVDGASNRTISPKKADILD
VVGMLYVGGLPINYTTRRIGPVTYSIDGCVRNLHMAEAPADLEQPTSSFHVGTCFANAQR
GTYFDGTGFAKAVGGFKVGLDLLVEFEFRTTTTTGVLLGISSQKMDGMGIEMIDEKLMFH
VDNGAGRFTAVYDAGVPGHLCDGQWHKVTANKIKHRIELTVDGNQVEAQSPNPASTSADT
NDPVFVGGFPDDLKQFGLTTSIPFRGCIRSLKLTKGTGKPLEVNFAKALELRGVQPVSCP
AN
NT seq 9369 nt NT seq  +upstreamnt  +downstreamnt
atgccgggagccgccggggtcctcctccttctgctgctctccggaggcctcgggggcgta
caggcgcagcggccgcagcagcagcggcagtcacaggcacatcagcaaagaggtttattc
cctgctgtcctgaatcttgcttctaatgctcttatcacgaccaatgcaacatgtggagaa
aaaggacctgaaatgtactgcaaattggtagaacatgtccctgggcagcctgtgaggaac
ccgcagtgtcgaatctgcaatcaaaacagcagcaatccaaaccagagacacccgattaca
aatgctattgatggaaagaacacttggtggcagagtcccagtattaagaatggaatcgaa
taccattatgtgacaattaccctggatttacagcaggtgttccagatcgcgtatgtgatt
gtgaaggcagctaactccccccggcctggaaactggattttggaacgctctcttgatgat
gttgaatacaagccctggcagtatcatgctgtgacagacacggagtgcctaacgctttac
aatatttatccccgcactgggccaccgtcatatgccaaagatgatgaggtcatctgcact
tcattttactccaagatacaccccttagaaaatggagagattcacatctctttaatcaat
gggagaccaagtgccgatgatccttctccagaactgctagaatttacctccgctcgctat
attcgcctgagatttcagaggatccgcacactgaatgctgacttgatgatgtttgctcac
aaagacccaagagaaattgaccccattgtcaccagaagatattactactcggtcaaggat
atttcagttggagggatgtgcatctgctatggtcatgccagggcttgtccacttgatcca
gcgacaaataaatctcgctgtgagtgtgagcataacacatgtggcgatagctgtgatcag
tgctgtccaggattccatcagaaaccctggagagctggaacttttctaactaaaactgaa
tgtgaagcatgcaattgtcatggaaaagctgaagaatgctattatgatgaaaatgttgcc
agaagaaatctgagtttgaatatacgtggaaagtacattggagggggtgtctgcattaat
tgtacccaaaacactgctggtataaactgcgagacatgtactgatggcttcttcagaccc
aaaggggtatctccaaattatccaaggccatgccagccatgtcattgcgatccaattggt
tccttaaatgaagtctgtgtcaaggatgagaaacatgctcgacgaggtttggcacctgga
tcctgtcattgcaaaactggttttggaggtgtgagctgtgatcggtgtgccaggggctac
actggctacccggactgcaaagcctgtaactgcagtgggttagggagcaaaaatgaggat
ccttgttttggcccctgtatctgcaaggaaaatgttgaaggaggagactgtagtcgttgc
aaatccggcttcttcaatttgcaagaggataattggaaaggctgcgatgagtgtttctgt
tcaggggtttcaaacagatgtcagagttcctactggacctatggcaaaatacaagatatg
agtggctggtatctgactgaccttcctggccgcattcgagtggctccccagcaggacgac
ttggactcacctcagcagatcagcatcagtaacgcggaggcccggcaagccctgccgcac
agctactactggagcgcgccggctccctatctgggaaacaaactcccagcagtaggagga
cagttgacatttaccatatcatatgaccttgaagaagaggaagaagatacagaacgtgtt
ctccagcttatgattatcttagagggtaatgacttgagcatcagcacagcccaagatgag
gtgtacctgcacccatctgaagaacatactaatgtattgttacttaaagaagaatcattt
accatacatggcacacattttccagtccgtagaaaggaatttatgacagtgcttgcgaat
ttgaagagagtcctcctacaaatcacatacagctttgggatggatgccatcttcaggttg
agctctgttaaccttgaatccgctgtctcctatcctactgatggaagcattgcagcagct
gtagaagtgtgtcagtgcccaccagggtatactggctcctcttgtgaatcttgttggcct
aggcacaggcgagttaacggcactatttttggtggcatctgtgagccatgtcagtgcttt
ggtcatgcggagtcctgtgatgacgtcactggagaatgcctgaactgtaaggatcacaca
ggtggcccatattgtgataaatgtcttcctggtttctatggcgagcctactaaaggaacc
tctgaagactgtcaaccctgtgcctgtccactcaatatcccatccaataactttagccca
acgtgccatttagaccggagtcttggattgatctgtgatggatgccctgtcgggtacaca
ggaccacgctgtgagaggtgtgcagaaggctattttggacaaccctctgtacctggagga
tcatgtcagccatgccaatgcaatgacaaccttgacttctccatccctggcagctgtgac
agcttgtctggctcctgtctgatatgtaaaccaggtacaacaggccggtactgtgagctc
tgtgctgatggatattttggagatgcagttgatgcgaagaactgtcagccctgtcgctgt
aatgccggtggctctttctctgaggtttgccacagtcaaactggacagtgtgagtgcaga
gccaacgttcagggtcagagatgtgacaaatgcaaggctgggacctttggcctacaatca
gcaaggggctgtgttccctgcaactgcaattcttttgggtctaagtcattcgactgtgaa
gagagtggacaatgttggtgccaacctggagtcacagggaagaaatgtgaccgctgtgcc
cacggctatttcaacttccaagaaggaggctgcacagcttgtgaatgttctcatctgggt
aataattgtgacccaaagactgggcgatgcatttgccctcccaataccattggagagaaa
tgttctaaatgtgcacccaatacctggggccacagcattaccactggttgtaaggcttgt
aactgcagcacagtgggatccttggatttccaatgcaatgtaaatacaggccaatgcaac
tgtcatccaaaattctctggtgcaaaatgtacagagtgcagtcgaggtcactggaactac
cctcgctgcaatctctgtgactgcttcctccctgggacagatgccacaacctgtgattca
gagactaaaaaatgctcctgtagtgatcaaactgggcagtgcacttgtaaggtgaatgtg
gaaggcatccactgtgacagatgccggcctggcaaattcggactcgatgccaagaatcca
cttggctgcagcagctgctattgcttcggcactactacccagtgctctgaagcaaaagga
ctgatccggacgtgggtgactctgaaggctgagcagaccattctacccctggtagatgag
gctctgcagcacacgaccaccaagggcattgtttttcaacatccagagattgttgcccac
atggacctgatgagagaagatctccatttggaacctttttattggaaacttccagaacaa
tttgaaggaaagaagttgatggcctatgggggcaaactcaagtatgcaatctatttcgag
gctcgggaagaaacaggtttctctacatataatcctcaagtgatcattcgaggtgggaca
cctactcatgctagaattatcgtcaggcatatggctgctcctctgattggccaattgaca
aggcatgaaattgaaatgacagagaaagaatggaaatattatggggatgatcctcgagtc
catagaactgtgacccgagaagacttcttggatatactatatgatattcattacattctt
atcaaagctacttatggaaatttcatgcgacaaagcaggatttctgaaatctcaatggag
gtagctgaacaaggacgtggaacaacaatgactcctccagctgacttgattgaaaaatgt
gattgtcccctgggctattctggcctgtcctgtgaggcatgcttgccgggattttatcga
ctgcgttctcaaccaggtggccgcacccctggaccaaccctgggcacctgtgttccatgt
caatgtaatggacacagcagcctgtgtgaccctgaaacatcgatatgccagaattgtcaa
catcacactgctggtgacttctgtgaacgatgtgctcttggatactatggaattgtcaag
ggattgccaaatgactgtcagcaatgtgcctgccctctgatttcttccagtaacaatttc
agcccctcttgtgtcgcagaaggacttgacgactaccgctgcacggcttgtccacgggga
tatgaaggccagtactgtgaaaggtgtgcccctggctatactggcagtccaggcaaccct
ggaggctcctgccaagaatgtgagtgtgatccctatggctcactgcctgtgccctgtgac
cctgtcacaggattctgcacgtgccgacctggagccacgggaaggaagtgtgacggctgc
aagcactggcatgcacgcgagggctgggagtgtgttttttgtggagatgagtgcactggc
cttcttctcggtgacttggctcgcctggagcagatggtcatgagcatcaacctcactggt
ccgctgcctgcgccatataaaatgctgtatggtcttgaaaatatgactcaggagctaaag
cacttgctgtcacctcagcgggccccagagaggcttattcagctggcagagggcaatctg
aatacactcgtgaccgaaatgaacgagctgctgaccagggctaccaaagtgacagcagat
ggcgagcagaccggacaggatgctgagaggaccaacacaagagcaaagtccctgggagaa
ttcattaaggagcttgcccgggatgcagaagctgtaaatgaaaaagctataaaactaaat
gaaactctaggaactcgagacgaggcctttgagagaaatttggaagggcttcagaaagag
attgaccagatgattaaagaactgaggaggaaaaatctagagacacaaaaggaaattgct
gaagatgagttggtagctgcagaagcccttctgaaaaaagtgaagaagctgtttggagag
tcccggggggaaaatgaagaaatggagaaggatctccgggaaaaactggctgactacaaa
aacaaagttgatgatgcttgggaccttttgagagaagccacagataaaatcagagaagct
aatcgcctatttgcagtaaatcagaaaaacatgactgcattggagaaaaagaaggaggct
gttgaaagcggcaaacgacaaattgagaacactttaaaagagggcaatgacatactcgat
gaagccaaccgtcttgcagatgaaatcaactccatcatagactatgttgaagacatccaa
actaaattgccacctatgtctgaggagcttaatgataaaatagatgacctctcccaagaa
ataaaggacaggaagcttgctgagaaggtgtcccaggctgagagccacgcagctcagttg
aatgactcatctgctgtccttgatggaatccttgatgaggctaaaaacatctccttcaat
gccactgcagccttcaaagcttacagcaatattaaggactatattgatgaagctgagaaa
gttgccaaagaagccaaagatcttgcacatgaagctacaaaactggcaacaggtcctcgg
ggtttattaaaggaagatgccaaaggctgtcttcagaaaagcttcaggattcttaacgaa
gccaagaagttagcaaatgatgtaaaagaaaatgaagaccatctaaatggcttaaaaacc
aggatagaaaatgctgatgctagaaatggggatctcttgagaactttgaatgacactttg
ggaaagttatcagctattccaaatgatacagctgctaaactgcaagctgttaaggacaaa
gccagacaagccaacgacacagctaaagatgtactggcacagattacagagctccaccag
aacctcgatggcctgaagaagaattacaataaactagcagacagcgtcgccaaaacgaat
gctgtggttaaagatccttccaagaacaaaatcattgccgatgcagatgccactgtcaaa
aatttagaacaggaagctgaccggctaatagataaactcaaacccatcaaggaacttgag
gataacctaaagaaaaacatctctgagataaaggaattgataaaccaagctcggaaacaa
gccaattctatcaaagtatctgtgtcttcaggaggtgactgcattcgaacatacaaacca
gaaatcaagaaaggaagttacaataatattgttgtcaacgtaaagacagctgttgctgat
aacctcctcttttatcttggaagtgccaaatttattgactttctggctatagaaatgcgt
aaaggcaaagtcagcttcctctgggatgttggatctggagttggacgtgtagagtaccca
gatttgactattgatgactcatattggtaccgtatcgtagcatcaagaactgggagaaat
ggaactatttctgtgagagccctggatggacccaaagccagcattgtgcccagcacacac
cattcgacgtctcctccagggtacacgattctagatgtggatgcaaatgcaatgctgttt
gttggtggcctgactgggaaattaaagaaggctgatgctgtacgtgtgattacattcact
ggctgcatgggagaaacatactttgacaacaaacctataggtttgtggaatttccgagaa
aaagaaggtgactgcaaaggatgcactgtcagtcctcaggtggaagatagtgaggggact
attcaatttgatggagaaggttatgcattggtcagccgtcccattcgctggtaccccaac
atctccactgtcatgttcaagttcagaacattttcttcgagtgctcttctgatgtatctt
gccacacgagacctgagagatttcatgagtgtggagctcactgatgggcacataaaagtc
agttacgatctgggctcaggaatggcttccgttgtcagcaatcaaaaccataatgatggg
aaatggaaatcattcactctgtcaagaattcaaaaacaagccaatatatcaattgtagat
atagatactaatcaggaggagaatatagcaacttcgtcttctggaaacaactttggtctt
gacttgaaagcagatgacaaaatatattttggtggcctgccaacgctgagaaacttgagt
atgaaagcaaggccagaagtaaatctgaagaaatattccggctgcctcaaagatattgaa
atttcaagaactccgtacaatatactcagtagtcccgattatgttggtgttaccaaagga
tgttccctggagaatgtttacacagttagctttcctaagcctggttttgtggagctctcc
cctgtgccaattgatgtaggaacagaaatcaacctgtcattcagcaccaagaatgagtcc
ggcatcattcttttgggaagtggagggacaccagcaccacctaggagaaaacgaaggcag
actggacaggcctattatgtaatactcctcaacaggggccgtctggaagtgcatctctcc
acaggggcacgaacaatgaggaaaattgtgatcagaccagagccgaatctgtttcatgat
ggaagagaacattccgttcatgtagagcgaactagaggcatctttacagttcaagtggat
gaaaacagaagatacatgcaaaacctgacagttgaacagcctatcgaagttaaaaagctt
ttcgttgggggtgctccacctgaatttcaaccttccccactcagaaatattcctcctttt
gaaggctgcatatggaatcttgttattaactctgtccccatggactttgcaaggcctgtg
tccttcaaaaatgctgacattggtcgctgtgcccatcagaaactccgtgaagatgaagat
ggagcagctccagctgaaatagttatccagcctgagccagttcccaccccagcctttcct
acgcccaccccagttctgacacatggtccttgtgctgcagaatcagaaccagctcttttg
atagggagcaagcagttcgggctttcaagaaacagtcacattgcaattgcatttgatgac
accaaagttaaaaaccgtctcacaattgagttggaagtaagaaccgaagctgaatccggc
ttgcttttttacatggctcgcatcaatcatgctgattttgcaacagttcagctgagaaat
ggattgccctacttcagctatgacttggggagtggggacacccacaccatgatccccacc
aaaatcaatgatggccagtggcacaagattaagataatgagaagtaagcaagaaggaatt
ctttatgtagatggggcttccaacagaaccatcagtcccaaaaaagccgacatcctggat
gtcgtgggaatgctgtatgttggtgggttacccatcaactacactacccgaagaattggt
ccagtgacctatagcattgatggctgcgtcaggaatctccacatggcagaggcccctgcc
gatctggaacaacccacctccagcttccatgttgggacatgttttgcaaatgctcagagg
ggaacatattttgacggaaccggttttgccaaagcagttggtggattcaaagtgggattg
gaccttcttgtagaatttgaattccgcacaactacaacgactggagttcttctggggatc
agtagtcaaaaaatggatggaatgggtattgaaatgattgatgaaaagttgatgtttcat
gtggacaatggtgcgggcagattcactgctgtctatgatgctggggttccagggcatttg
tgtgatggacaatggcataaagtcactgccaacaagatcaaacaccgcattgagctcaca
gtcgatgggaaccaggtggaagcccaaagcccaaacccagcatctacatcagctgacaca
aatgaccctgtgtttgttggaggcttcccagatgacctcaagcagtttggcctaacaacc
agtattccgttccgaggttgcatcagatccctgaagctcaccaaaggcacaggcaagcca
ctggaggttaattttgccaaggccctggaactgaggggcgttcaacctgtatcatgccca
gccaactaa

DBGET integrated database retrieval system