KEGG   Homo sapiens (human): 3908Help
Entry
3908              CDS       T01001                                 

Gene name
LAMA2, LAMM
Definition
laminin, alpha 2
Orthology
K05637  
laminin, alpha 1/2
Organism
hsa  Homo sapiens (human)
Pathway
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Toxoplasmosis
Amoebiasis
Pathways in cancer
Small cell lung cancer
Hypertrophic cardiomyopathy (HCM)
Arrhythmogenic right ventricular cardiomyopathy (ARVC)
Dilated cardiomyopathy
Viral myocarditis
Disease
H00590  
Congenital muscular dystrophies (CMD/MDC)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    3908 (LAMA2)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    3908 (LAMA2)
 Cellular Processes
  Cellular commiunity
   04510 Focal adhesion
    3908 (LAMA2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    3908 (LAMA2)
   05222 Small cell lung cancer
    3908 (LAMA2)
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    3908 (LAMA2)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    3908 (LAMA2)
   05414 Dilated cardiomyopathy (DCM)
    3908 (LAMA2)
   05416 Viral myocarditis
    3908 (LAMA2)
  Infectious diseases
   05146 Amoebiasis
    3908 (LAMA2)
   05145 Toxoplasmosis
    3908 (LAMA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
6q22-q23
AA seq 3122 aa AA seqDB search
MPGAAGVLLLLLLSGGLGGVQAQRPQQQRQSQAHQQRGLFPAVLNLASNALITTNATCGE
KGPEMYCKLVEHVPGQPVRNPQCRICNQNSSNPNQRHPITNAIDGKNTWWQSPSIKNGIE
YHYVTITLDLQQVFQIAYVIVKAANSPRPGNWILERSLDDVEYKPWQYHAVTDTECLTLY
NIYPRTGPPSYAKDDEVICTSFYSKIHPLENGEIHISLINGRPSADDPSPELLEFTSARY
IRLRFQRIRTLNADLMMFAHKDPREIDPIVTRRYYYSVKDISVGGMCICYGHARACPLDP
ATNKSRCECEHNTCGDSCDQCCPGFHQKPWRAGTFLTKTECEACNCHGKAEECYYDENVA
RRNLSLNIRGKYIGGGVCINCTQNTAGINCETCTDGFFRPKGVSPNYPRPCQPCHCDPIG
SLNEVCVKDEKHARRGLAPGSCHCKTGFGGVSCDRCARGYTGYPDCKACNCSGLGSKNED
PCFGPCICKENVEGGDCSRCKSGFFNLQEDNWKGCDECFCSGVSNRCQSSYWTYGKIQDM
SGWYLTDLPGRIRVAPQQDDLDSPQQISISNAEARQALPHSYYWSAPAPYLGNKLPAVGG
QLTFTISYDLEEEEEDTERVLQLMIILEGNDLSISTAQDEVYLHPSEEHTNVLLLKEESF
TIHGTHFPVRRKEFMTVLANLKRVLLQITYSFGMDAIFRLSSVNLESAVSYPTDGSIAAA
VEVCQCPPGYTGSSCESCWPRHRRVNGTIFGGICEPCQCFGHAESCDDVTGECLNCKDHT
GGPYCDKCLPGFYGEPTKGTSEDCQPCACPLNIPSNNFSPTCHLDRSLGLICDGCPVGYT
GPRCERCAEGYFGQPSVPGGSCQPCQCNDNLDFSIPGSCDSLSGSCLICKPGTTGRYCEL
CADGYFGDAVDAKNCQPCRCNAGGSFSEVCHSQTGQCECRANVQGQRCDKCKAGTFGLQS
ARGCVPCNCNSFGSKSFDCEESGQCWCQPGVTGKKCDRCAHGYFNFQEGGCTACECSHLG
NNCDPKTGRCICPPNTIGEKCSKCAPNTWGHSITTGCKACNCSTVGSLDFQCNVNTGQCN
CHPKFSGAKCTECSRGHWNYPRCNLCDCFLPGTDATTCDSETKKCSCSDQTGQCTCKVNV
EGIHCDRCRPGKFGLDAKNPLGCSSCYCFGTTTQCSEAKGLIRTWVTLKAEQTILPLVDE
ALQHTTTKGIVFQHPEIVAHMDLMREDLHLEPFYWKLPEQFEGKKLMAYGGKLKYAIYFE
AREETGFSTYNPQVIIRGGTPTHARIIVRHMAAPLIGQLTRHEIEMTEKEWKYYGDDPRV
HRTVTREDFLDILYDIHYILIKATYGNFMRQSRISEISMEVAEQGRGTTMTPPADLIEKC
DCPLGYSGLSCEACLPGFYRLRSQPGGRTPGPTLGTCVPCQCNGHSSLCDPETSICQNCQ
HHTAGDFCERCALGYYGIVKGLPNDCQQCACPLISSSNNFSPSCVAEGLDDYRCTACPRG
YEGQYCERCAPGYTGSPGNPGGSCQECECDPYGSLPVPCDPVTGFCTCRPGATGRKCDGC
KHWHAREGWECVFCGDECTGLLLGDLARLEQMVMSINLTGPLPAPYKMLYGLENMTQELK
HLLSPQRAPERLIQLAEGNLNTLVTEMNELLTRATKVTADGEQTGQDAERTNTRAKSLGE
FIKELARDAEAVNEKAIKLNETLGTRDEAFERNLEGLQKEIDQMIKELRRKNLETQKEIA
EDELVAAEALLKKVKKLFGESRGENEEMEKDLREKLADYKNKVDDAWDLLREATDKIREA
NRLFAVNQKNMTALEKKKEAVESGKRQIENTLKEGNDILDEANRLADEINSIIDYVEDIQ
TKLPPMSEELNDKIDDLSQEIKDRKLAEKVSQAESHAAQLNDSSAVLDGILDEAKNISFN
ATAAFKAYSNIKDYIDEAEKVAKEAKDLAHEATKLATGPRGLLKEDAKGCLQKSFRILNE
AKKLANDVKENEDHLNGLKTRIENADARNGDLLRTLNDTLGKLSAIPNDTAAKLQAVKDK
ARQANDTAKDVLAQITELHQNLDGLKKNYNKLADSVAKTNAVVKDPSKNKIIADADATVK
NLEQEADRLIDKLKPIKELEDNLKKNISEIKELINQARKQANSIKVSVSSGGDCIRTYKP
EIKKGSYNNIVVNVKTAVADNLLFYLGSAKFIDFLAIEMRKGKVSFLWDVGSGVGRVEYP
DLTIDDSYWYRIVASRTGRNGTISVRALDGPKASIVPSTHHSTSPPGYTILDVDANAMLF
VGGLTGKLKKADAVRVITFTGCMGETYFDNKPIGLWNFREKEGDCKGCTVSPQVEDSEGT
IQFDGEGYALVSRPIRWYPNISTVMFKFRTFSSSALLMYLATRDLRDFMSVELTDGHIKV
SYDLGSGMASVVSNQNHNDGKWKSFTLSRIQKQANISIVDIDTNQEENIATSSSGNNFGL
DLKADDKIYFGGLPTLRNLSMKARPEVNLKKYSGCLKDIEISRTPYNILSSPDYVGVTKG
CSLENVYTVSFPKPGFVELSPVPIDVGTEINLSFSTKNESGIILLGSGGTPAPPRRKRRQ
TGQAYYVILLNRGRLEVHLSTGARTMRKIVIRPEPNLFHDGREHSVHVERTRGIFTVQVD
ENRRYMQNLTVEQPIEVKKLFVGGAPPEFQPSPLRNIPPFEGCIWNLVINSVPMDFARPV
SFKNADIGRCAHQKLREDEDGAAPAEIVIQPEPVPTPAFPTPTPVLTHGPCAAESEPALL
IGSKQFGLSRNSHIAIAFDDTKVKNRLTIELEVRTEAESGLLFYMARINHADFATVQLRN
GLPYFSYDLGSGDTHTMIPTKINDGQWHKIKIMRSKQEGILYVDGASNRTISPKKADILD
VVGMLYVGGLPINYTTRRIGPVTYSIDGCVRNLHMAEAPADLEQPTSSFHVGTCFANAQR
GTYFDGTGFAKAVGGFKVGLDLLVEFEFRTTTTTGVLLGISSQKMDGMGIEMIDEKLMFH
VDNGAGRFTAVYDAGVPGHLCDGQWHKVTANKIKHRIELTVDGNQVEAQSPNPASTSADT
NDPVFVGGFPDDLKQFGLTTSIPFRGCIRSLKLTKGTGKPLEVNFAKALELRGVQPVSCP
AN
NT seq 9369 nt NT seq  +upstreamnt  +downstreamnt
atgccgggagccgccggggtcctcctccttctgctgctctccggaggcctcgggggcgta
caggcgcagcggccgcagcagcagcggcagtcacaggcacatcagcaaagaggtttattc
cctgctgtcctgaatcttgcttctaatgctcttatcacgaccaatgcaacatgtggagaa
aaaggacctgaaatgtactgcaaattggtagaacatgtccctgggcagcctgtgaggaac
ccgcagtgtcgaatctgcaatcaaaacagcagcaatccaaaccagagacacccgattaca
aatgctattgatggaaagaacacttggtggcagagtcccagtattaagaatggaatcgaa
taccattatgtgacaattaccctggatttacagcaggtgttccagatcgcgtatgtgatt
gtgaaggcagctaactccccccggcctggaaactggattttggaacgctctcttgatgat
gttgaatacaagccctggcagtatcatgctgtgacagacacggagtgcctaacgctttac
aatatttatccccgcactgggccaccgtcatatgccaaagatgatgaggtcatctgcact
tcattttactccaagatacaccccttagaaaatggagagattcacatctctttaatcaat
gggagaccaagtgccgatgatccttctccagaactgctagaatttacctccgctcgctat
attcgcctgagatttcagaggatccgcacactgaatgctgacttgatgatgtttgctcac
aaagacccaagagaaattgaccccattgtcaccagaagatattactactcggtcaaggat
atttcagttggagggatgtgcatctgctatggtcatgccagggcttgtccacttgatcca
gcgacaaataaatctcgctgtgagtgtgagcataacacatgtggcgatagctgtgatcag
tgctgtccaggattccatcagaaaccctggagagctggaacttttctaactaaaactgaa
tgtgaagcatgcaattgtcatggaaaagctgaagaatgctattatgatgaaaatgttgcc
agaagaaatctgagtttgaatatacgtggaaagtacattggagggggtgtctgcattaat
tgtacccaaaacactgctggtataaactgcgagacatgtactgatggcttcttcagaccc
aaaggggtatctccaaattatccaaggccatgccagccatgtcattgcgatccaattggt
tccttaaatgaagtctgtgtcaaggatgagaaacatgctcgacgaggtttggcacctgga
tcctgtcattgcaaaactggttttggaggtgtgagctgtgatcggtgtgccaggggctac
actggctacccggactgcaaagcctgtaactgcagtgggttagggagcaaaaatgaggat
ccttgttttggcccctgtatctgcaaggaaaatgttgaaggaggagactgtagtcgttgc
aaatccggcttcttcaatttgcaagaggataattggaaaggctgcgatgagtgtttctgt
tcaggggtttcaaacagatgtcagagttcctactggacctatggcaaaatacaagatatg
agtggctggtatctgactgaccttcctggccgcattcgagtggctccccagcaggacgac
ttggactcacctcagcagatcagcatcagtaacgcggaggcccggcaagccctgccgcac
agctactactggagcgcgccggctccctatctgggaaacaaactcccagcagtaggagga
cagttgacatttaccatatcatatgaccttgaagaagaggaagaagatacagaacgtgtt
ctccagcttatgattatcttagagggtaatgacttgagcatcagcacagcccaagatgag
gtgtacctgcacccatctgaagaacatactaatgtattgttacttaaagaagaatcattt
accatacatggcacacattttccagtccgtagaaaggaatttatgacagtgcttgcgaat
ttgaagagagtcctcctacaaatcacatacagctttgggatggatgccatcttcaggttg
agctctgttaaccttgaatccgctgtctcctatcctactgatggaagcattgcagcagct
gtagaagtgtgtcagtgcccaccagggtatactggctcctcttgtgaatcttgttggcct
aggcacaggcgagttaacggcactatttttggtggcatctgtgagccatgtcagtgcttt
ggtcatgcggagtcctgtgatgacgtcactggagaatgcctgaactgtaaggatcacaca
ggtggcccatattgtgataaatgtcttcctggtttctatggcgagcctactaaaggaacc
tctgaagactgtcaaccctgtgcctgtccactcaatatcccatccaataactttagccca
acgtgccatttagaccggagtcttggattgatctgtgatggatgccctgtcgggtacaca
ggaccacgctgtgagaggtgtgcagaaggctattttggacaaccctctgtacctggagga
tcatgtcagccatgccaatgcaatgacaaccttgacttctccatccctggcagctgtgac
agcttgtctggctcctgtctgatatgtaaaccaggtacaacaggccggtactgtgagctc
tgtgctgatggatattttggagatgcagttgatgcgaagaactgtcagccctgtcgctgt
aatgccggtggctctttctctgaggtttgccacagtcaaactggacagtgtgagtgcaga
gccaacgttcagggtcagagatgtgacaaatgcaaggctgggacctttggcctacaatca
gcaaggggctgtgttccctgcaactgcaattcttttgggtctaagtcattcgactgtgaa
gagagtggacaatgttggtgccaacctggagtcacagggaagaaatgtgaccgctgtgcc
cacggctatttcaacttccaagaaggaggctgcacagcttgtgaatgttctcatctgggt
aataattgtgacccaaagactgggcgatgcatttgccctcccaataccattggagagaaa
tgttctaaatgtgcacccaatacctggggccacagcattaccactggttgtaaggcttgt
aactgcagcacagtgggatccttggatttccaatgcaatgtaaatacaggccaatgcaac
tgtcatccaaaattctctggtgcaaaatgtacagagtgcagtcgaggtcactggaactac
cctcgctgcaatctctgtgactgcttcctccctgggacagatgccacaacctgtgattca
gagactaaaaaatgctcctgtagtgatcaaactgggcagtgcacttgtaaggtgaatgtg
gaaggcatccactgtgacagatgccggcctggcaaattcggactcgatgccaagaatcca
cttggctgcagcagctgctattgcttcggcactactacccagtgctctgaagcaaaagga
ctgatccggacgtgggtgactctgaaggctgagcagaccattctacccctggtagatgag
gctctgcagcacacgaccaccaagggcattgtttttcaacatccagagattgttgcccac
atggacctgatgagagaagatctccatttggaacctttttattggaaacttccagaacaa
tttgaaggaaagaagttgatggcctatgggggcaaactcaagtatgcaatctatttcgag
gctcgggaagaaacaggtttctctacatataatcctcaagtgatcattcgaggtgggaca
cctactcatgctagaattatcgtcaggcatatggctgctcctctgattggccaattgaca
aggcatgaaattgaaatgacagagaaagaatggaaatattatggggatgatcctcgagtc
catagaactgtgacccgagaagacttcttggatatactatatgatattcattacattctt
atcaaagctacttatggaaatttcatgcgacaaagcaggatttctgaaatctcaatggag
gtagctgaacaaggacgtggaacaacaatgactcctccagctgacttgattgaaaaatgt
gattgtcccctgggctattctggcctgtcctgtgaggcatgcttgccgggattttatcga
ctgcgttctcaaccaggtggccgcacccctggaccaaccctgggcacctgtgttccatgt
caatgtaatggacacagcagcctgtgtgaccctgaaacatcgatatgccagaattgtcaa
catcacactgctggtgacttctgtgaacgatgtgctcttggatactatggaattgtcaag
ggattgccaaatgactgtcagcaatgtgcctgccctctgatttcttccagtaacaatttc
agcccctcttgtgtcgcagaaggacttgacgactaccgctgcacggcttgtccacgggga
tatgaaggccagtactgtgaaaggtgtgcccctggctatactggcagtccaggcaaccct
ggaggctcctgccaagaatgtgagtgtgatccctatggctcactgcctgtgccctgtgac
cctgtcacaggattctgcacgtgccgacctggagccacgggaaggaagtgtgacggctgc
aagcactggcatgcacgcgagggctgggagtgtgttttttgtggagatgagtgcactggc
cttcttctcggtgacttggctcgcctggagcagatggtcatgagcatcaacctcactggt
ccgctgcctgcgccatataaaatgctgtatggtcttgaaaatatgactcaggagctaaag
cacttgctgtcacctcagcgggccccagagaggcttattcagctggcagagggcaatctg
aatacactcgtgaccgaaatgaacgagctgctgaccagggctaccaaagtgacagcagat
ggcgagcagaccggacaggatgctgagaggaccaacacaagagcaaagtccctgggagaa
ttcattaaggagcttgcccgggatgcagaagctgtaaatgaaaaagctataaaactaaat
gaaactctaggaactcgagacgaggcctttgagagaaatttggaagggcttcagaaagag
attgaccagatgattaaagaactgaggaggaaaaatctagagacacaaaaggaaattgct
gaagatgagttggtagctgcagaagcccttctgaaaaaagtgaagaagctgtttggagag
tcccggggggaaaatgaagaaatggagaaggatctccgggaaaaactggctgactacaaa
aacaaagttgatgatgcttgggaccttttgagagaagccacagataaaatcagagaagct
aatcgcctatttgcagtaaatcagaaaaacatgactgcattggagaaaaagaaggaggct
gttgaaagcggcaaacgacaaattgagaacactttaaaagagggcaatgacatactcgat
gaagccaaccgtcttgcagatgaaatcaactccatcatagactatgttgaagacatccaa
actaaattgccacctatgtctgaggagcttaatgataaaatagatgacctctcccaagaa
ataaaggacaggaagcttgctgagaaggtgtcccaggctgagagccacgcagctcagttg
aatgactcatctgctgtccttgatggaatccttgatgaggctaaaaacatctccttcaat
gccactgcagccttcaaagcttacagcaatattaaggactatattgatgaagctgagaaa
gttgccaaagaagccaaagatcttgcacatgaagctacaaaactggcaacaggtcctcgg
ggtttattaaaggaagatgccaaaggctgtcttcagaaaagcttcaggattcttaacgaa
gccaagaagttagcaaatgatgtaaaagaaaatgaagaccatctaaatggcttaaaaacc
aggatagaaaatgctgatgctagaaatggggatctcttgagaactttgaatgacactttg
ggaaagttatcagctattccaaatgatacagctgctaaactgcaagctgttaaggacaaa
gccagacaagccaacgacacagctaaagatgtactggcacagattacagagctccaccag
aacctcgatggcctgaagaagaattacaataaactagcagacagcgtcgccaaaacgaat
gctgtggttaaagatccttccaagaacaaaatcattgccgatgcagatgccactgtcaaa
aatttagaacaggaagctgaccggctaatagataaactcaaacccatcaaggaacttgag
gataacctaaagaaaaacatctctgagataaaggaattgataaaccaagctcggaaacaa
gccaattctatcaaagtatctgtgtcttcaggaggtgactgcattcgaacatacaaacca
gaaatcaagaaaggaagttacaataatattgttgtcaacgtaaagacagctgttgctgat
aacctcctcttttatcttggaagtgccaaatttattgactttctggctatagaaatgcgt
aaaggcaaagtcagcttcctctgggatgttggatctggagttggacgtgtagagtaccca
gatttgactattgatgactcatattggtaccgtatcgtagcatcaagaactgggagaaat
ggaactatttctgtgagagccctggatggacccaaagccagcattgtgcccagcacacac
cattcgacgtctcctccagggtacacgattctagatgtggatgcaaatgcaatgctgttt
gttggtggcctgactgggaaattaaagaaggctgatgctgtacgtgtgattacattcact
ggctgcatgggagaaacatactttgacaacaaacctataggtttgtggaatttccgagaa
aaagaaggtgactgcaaaggatgcactgtcagtcctcaggtggaagatagtgaggggact
attcaatttgatggagaaggttatgcattggtcagccgtcccattcgctggtaccccaac
atctccactgtcatgttcaagttcagaacattttcttcgagtgctcttctgatgtatctt
gccacacgagacctgagagatttcatgagtgtggagctcactgatgggcacataaaagtc
agttacgatctgggctcaggaatggcttccgttgtcagcaatcaaaaccataatgatggg
aaatggaaatcattcactctgtcaagaattcaaaaacaagccaatatatcaattgtagat
atagatactaatcaggaggagaatatagcaacttcgtcttctggaaacaactttggtctt
gacttgaaagcagatgacaaaatatattttggtggcctgccaacgctgagaaacttgagt
atgaaagcaaggccagaagtaaatctgaagaaatattccggctgcctcaaagatattgaa
atttcaagaactccgtacaatatactcagtagtcccgattatgttggtgttaccaaagga
tgttccctggagaatgtttacacagttagctttcctaagcctggttttgtggagctctcc
cctgtgccaattgatgtaggaacagaaatcaacctgtcattcagcaccaagaatgagtcc
ggcatcattcttttgggaagtggagggacaccagcaccacctaggagaaaacgaaggcag
actggacaggcctattatgtaatactcctcaacaggggccgtctggaagtgcatctctcc
acaggggcacgaacaatgaggaaaattgtgatcagaccagagccgaatctgtttcatgat
ggaagagaacattccgttcatgtagagcgaactagaggcatctttacagttcaagtggat
gaaaacagaagatacatgcaaaacctgacagttgaacagcctatcgaagttaaaaagctt
ttcgttgggggtgctccacctgaatttcaaccttccccactcagaaatattcctcctttt
gaaggctgcatatggaatcttgttattaactctgtccccatggactttgcaaggcctgtg
tccttcaaaaatgctgacattggtcgctgtgcccatcagaaactccgtgaagatgaagat
ggagcagctccagctgaaatagttatccagcctgagccagttcccaccccagcctttcct
acgcccaccccagttctgacacatggtccttgtgctgcagaatcagaaccagctcttttg
atagggagcaagcagttcgggctttcaagaaacagtcacattgcaattgcatttgatgac
accaaagttaaaaaccgtctcacaattgagttggaagtaagaaccgaagctgaatccggc
ttgcttttttacatggctcgcatcaatcatgctgattttgcaacagttcagctgagaaat
ggattgccctacttcagctatgacttggggagtggggacacccacaccatgatccccacc
aaaatcaatgatggccagtggcacaagattaagataatgagaagtaagcaagaaggaatt
ctttatgtagatggggcttccaacagaaccatcagtcccaaaaaagccgacatcctggat
gtcgtgggaatgctgtatgttggtgggttacccatcaactacactacccgaagaattggt
ccagtgacctatagcattgatggctgcgtcaggaatctccacatggcagaggcccctgcc
gatctggaacaacccacctccagcttccatgttgggacatgttttgcaaatgctcagagg
ggaacatattttgacggaaccggttttgccaaagcagttggtggattcaaagtgggattg
gaccttcttgtagaatttgaattccgcacaactacaacgactggagttcttctggggatc
agtagtcaaaaaatggatggaatgggtattgaaatgattgatgaaaagttgatgtttcat
gtggacaatggtgcgggcagattcactgctgtctatgatgctggggttccagggcatttg
tgtgatggacaatggcataaagtcactgccaacaagatcaaacaccgcattgagctcaca
gtcgatgggaaccaggtggaagcccaaagcccaaacccagcatctacatcagctgacaca
aatgaccctgtgtttgttggaggcttcccagatgacctcaagcagtttggcctaacaacc
agtattccgttccgaggttgcatcagatccctgaagctcaccaaaggcacaggcaagcca
ctggaggttaattttgccaaggccctggaactgaggggcgttcaacctgtatcatgccca
gccaactaa

DBGET integrated database retrieval system