KEGG   Homo sapiens (human): 3909Help
Entry
3909              CDS       T01001                                 

Gene name
LAMA3, BM600, E170, LAMNA, LOCS, lama3a
Definition
laminin, alpha 3
Orthology
K06240  
laminin, alpha 3/5
Organism
hsa  Homo sapiens (human)
Pathway
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Toxoplasmosis
Amoebiasis
Pathways in cancer
Small cell lung cancer
Disease
H00585  
Epidermolysis bullosa, hemidesmosomal
H00586  
Epidermolysis bullosa, junctional
H00813  
Laryngo onycho cutaneous syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    3909 (LAMA3)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    3909 (LAMA3)
 Cellular Processes
  Cellular commiunity
   04510 Focal adhesion
    3909 (LAMA3)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    3909 (LAMA3)
   05222 Small cell lung cancer
    3909 (LAMA3)
  Infectious diseases
   05146 Amoebiasis
    3909 (LAMA3)
   05145 Toxoplasmosis
    3909 (LAMA3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
18q11.2
AA seq 1724 aa AA seqDB search
MPPAVRRSACSMGWLWIFGAALGQCLGYSSQQQRVPFLQPPGQSQLQASYVEFRPSQGCS
PGYYRDHKGLYTGRCVPCNCNGHSNQCQDGSGICVNCQHNTAGEHCERCQEGYYGNAVHG
SCRACPCPHTNSFATGCVVNGGDVRCSCKAGYTGTQCERCAPGYFGNPQKFGGSCQPCSC
NSNGQLGSCHPLTGDCINQEPKDSSPAEECDDCDSCVMTLLNDLATMGEQLRLVKSQLQG
LSASAGLLEQMRHMETQAKDLRNQLLNYRSAISNHGSKIEGLERELTDLNQEFETLQEKA
QVNSRKAQTLNNNVNRATQSAKELDVKIKNVIRNVHILLKQISGTDGEGNNVPSGDFSRE
WAEAQRMMRELRNRNFGKHLREAEADKRESQLLLNRIRTWQKTHQGENNGLANSIRDSLN
EYEAKLSDLRARLQEAAAQAKQANGLNQENERALGAIQRQVKEINSLQSDFTKYLTTADS
SLLQTNIALQLMEKSQKEYEKLAASLNEARQELSDKVRELSRSAGKTSLVEEAEKHARSL
QELAKQLEEIKRNASGDELVRCAVDAATAYENILNAIKAAEDAANRAASASESALQTVIK
EDLPRKAKTLSSNSDKLLNEAKMTQKKLKQEVSPALNNLQQTLNIVTVQKEVIDTNLTTL
RDGLHGIQRGDIDAMISSAKSMVRKANDITDEVLDGLNPIQTDVERIKDTYGRTQNEDFK
KALTDADNSVNKLTNKLPDLWRKIESINQQLLPLGNISDNMDRIRELIQQARDAASKVAV
PMRFNGKSGVEVRLPNDLEDLKGYTSLSLFLQRPNSRENGGTENMFVMYLGNKDASRDYI
GMAVVDGQLTCVYNLGDREAELQVDQILTKSETKEAVMDRVKFQRIYQFARLNYTKGATS
SKPETPGVYDMDGRNSNTLLNLDPENVVFYVGGYPPDFKLPSRLSFPPYKGCIELDDLNE
NVLSLYNFKKTFNLNTTEVEPCRRRKEESDKNYFEGTGYARVPTQPHAPIPTFGQTIQTT
VDRGLLFFAENGDRFISLNIEDGKLMVRYKLNSELPKERGVGDAINNGRDHSIQIKIGKL
QKRMWINVDVQNTIIDGEVFDFSTYYLGGIPIAIRERFNISTPAFRGCMKNLKKTSGVVR
LNDTVGVTKKCSEDWKLVRSASFSRGGQLSFTDLGLPPTDHLQASFGFQTFQPSGILLDH
QTWTRNLQVTLEDGYIELSTSDSGSPIFKSPQTYMDGLLHYVSVISDNSGLRLLIDDQLL
RNSKRLKHISSSRQSLRLGGSNFEGCISNVFVQRLSLSPEVLDLTSNSLKRDVSLGGCSL
NKPPFLMLLKGSTRFNKTKTFRINQLLQDTPVASPRSVKVWQDACSPLPKTQANHGALQF
GDIPTSHLLFKLPQELLKPRSQFAVDMQTTSSRGLVFHTGTKNSFMALYLSKGRLVFALG
TDGKKLRIKSKEKCNDGKWHTVVFGHDGEKGRLVVDGLRAREGSLPGNSTISIRAPVYLG
SPPSGKPKSLPTNSFVGCLKNFQLDSKPLYTPSSSFGVSSCLGGPLEKGIYFSEEGGHVV
LAHSVLLGPEFKLVFSIRPRSLTGILIHIGSQPGKHLCVYLEAGKVTASMDSGAGGTSTS
VTPKQSLCDGQWHSVAVTIKQHILHLELDTDSSYTAGQIPFPPASTQEPLHLGGAPANLT
TLRIPVWKSFFGCLRNIHVNHIPVPVTEALEVQGPVSLNGCPDQ
NT seq 5175 nt NT seq  +upstreamnt  +downstreamnt
atgcctccagcagtgaggcggtcagcctgcagcatgggatggctgtggatctttggggca
gccctggggcagtgtctgggctacagttcacagcagcaaagggtgccatttcttcagcct
cccggtcaaagtcaactgcaagcgagttatgtggagtttagacccagccagggttgtagc
cctggatactatcgggatcataaaggcttgtataccggacggtgtgttccctgcaattgc
aacggacattcaaatcaatgccaggatggctcaggcatatgtgttaactgtcagcacaac
accgcgggagagcactgtgaacgctgccaggagggctactatggcaacgccgtccacgga
tcctgcagggcctgcccatgtcctcacactaacagctttgccactggctgtgtggtgaat
gggggagacgtgcggtgctcctgcaaagctgggtacacaggaacacagtgtgaaaggtgt
gcaccgggatatttcgggaatccccagaaattcggaggtagctgccaaccatgcagttgt
aacagcaatggccagctgggcagctgtcatcccctgactggagactgcataaaccaagaa
cccaaagatagcagccctgcagaagaatgtgatgattgcgacagctgtgtgatgaccctc
ctgaacgacctggccaccatgggcgagcagctccgcctggtcaagtctcagctgcagggc
ctgagtgccagcgcagggcttctggagcagatgaggcacatggagacccaggccaaggac
ctgaggaatcagttgctcaactaccgttctgccatttcaaatcatggatcaaaaatagaa
ggcctggaaagagaactgactgatttgaatcaagaatttgagactttgcaagaaaaggct
caagtaaattccagaaaagcacaaacattaaacaacaatgttaatcgggcaacacaaagc
gcaaaagaactggatgtgaagattaaaaatgtcatccggaatgtgcacattcttttaaag
cagatctctgggacagatggagagggaaacaacgtgccttcaggtgacttttccagagag
tgggctgaagcccagcgcatgatgagggaactgcggaacaggaactttggaaagcacctc
agagaagcagaagctgataaaagggagtcgcagctcttgctgaaccggataaggacctgg
cagaaaacccaccagggggagaacaatgggcttgctaacagtatccgggattctttaaat
gaatacgaagccaaactcagtgaccttcgtgctcggctgcaggaggcagctgcccaagcc
aagcaggcaaatggcttgaaccaagaaaacgagagagctttgggagccattcagagacaa
gtgaaagaaataaattccctgcagagtgatttcaccaagtatctaaccactgcagactca
tctttgttgcaaaccaacattgcgctgcagctgatggagaaaagccagaaggaatatgaa
aaattagctgccagtttaaatgaagcaagacaagaactaagtgacaaagtaagagaactt
tccagatctgctggcaaaacatcccttgtggaggaggcagaaaagcacgcgcggtcctta
caagagctggcaaagcagctggaagagatcaagagaaacgccagcggggatgagctggtg
cgctgtgctgtggatgccgccaccgcctacgagaacatcctcaatgccatcaaagcggcc
gaggacgcagccaacagggctgccagtgcatctgaatctgccctccagacagtgataaag
gaagatctgccaagaaaagctaaaaccctgagttccaacagtgataaactgttaaatgaa
gccaagatgacacaaaagaagctaaagcaagaagtcagtccagctctcaacaacctacag
caaaccctgaatattgtgacagttcagaaagaagtgatagacaccaatctcacaactctc
cgagatggtcttcatgggatacagagaggtgatattgatgctatgatcagtagtgcaaag
agcatggtcagaaaggccaacgacatcacagatgaggttctggatgggctcaaccccatc
cagacagatgtggaaagaattaaggacacctatgggaggacacagaacgaagacttcaaa
aaggctctgactgatgcagataactcggtgaataagttaaccaacaaactacctgatctt
tggcgcaagattgaaagtatcaaccaacagctgttgcccttgggaaacatctctgacaac
atggacagaatacgagaactaattcagcaggccagagatgctgccagtaaggttgctgtc
cccatgaggttcaatggtaaatctggagtcgaagtccgactgccaaatgacctggaagat
ttgaaaggatatacatctctgtccttgtttctccaaaggcccaactcaagagaaaatggg
ggtactgagaatatgtttgtgatgtaccttggaaataaagatgcctcccgggactacatc
ggcatggcagttgtggatggccagctcacctgtgtctacaacctgggggaccgtgaggct
gaactccaagtggaccagatcttgaccaagagtgagactaaggaggcagttatggatcgg
gtgaaatttcagagaatttatcagtttgcaaggcttaattacaccaaaggagccacatcc
agtaaaccagaaacacccggagtctatgacatggatggtagaaatagcaatacactcctt
aatttggatcctgaaaatgttgtattttatgttggaggttacccacctgattttaaactt
cccagtcgactaagtttccctccatacaaaggttgtattgaattagatgacctcaatgaa
aatgttctgagcttgtacaacttcaaaaaaacattcaatctcaacacaactgaagtggag
ccttgtagaaggaggaaggaagagtcagacaaaaattattttgaaggtacgggctatgct
cgagttccaactcaaccacatgctcccatcccaacctttggacagacaattcagaccacc
gtggatagaggcttgctgttctttgcagaaaacggggatcgcttcatatctctaaatata
gaagatggcaagctcatggtgagatacaaactgaattcagagctaccaaaagagagagga
gttggagacgccataaacaacggcagagaccattcgattcagatcaaaattggaaaactc
caaaagcgtatgtggataaatgtggacgttcaaaacactataattgatggtgaagtattt
gatttcagcacatattatctgggaggaattccaattgcaatcagggaaagatttaacatt
tctacgcctgctttccgaggctgcatgaaaaatttgaagaaaaccagtggtgtcgttaga
ttgaatgatactgtgggagtaaccaaaaagtgctcggaagactggaagcttgtgcgatct
gcctcattctccagaggaggacaattgagtttcactgatttgggcttaccacctactgac
cacctccaggcctcatttggatttcagacctttcaacccagtggcatattattagatcat
cagacatggacaaggaacctgcaggtcactctggaagatggttacattgaattgagcacc
agcgatagcggcagcccaatttttaaatctccacagacgtatatggatggtttactgcat
tatgtatctgtaataagcgacaactctggactacggcttctcatcgatgaccagcttctg
agaaatagcaaaaggctaaaacacatttcaagttcccggcagtctctgcgtctgggcggg
agcaattttgagggttgtattagcaatgtttttgtccagaggttatcactgagtcctgaa
gtcctagatttgaccagtaactctctcaagagagatgtgtccctgggaggctgcagttta
aacaaaccaccttttctaatgttgcttaaaggttctaccaggtttaacaagaccaagact
tttcgtatcaaccagctgttgcaggacacaccagtggcctccccaaggagcgtgaaggtg
tggcaagatgcttgctcaccacttcccaagacccaggccaatcatggagccctccagttt
ggggacattcccaccagccacttgctattcaagcttcctcaggagctgctgaaacccagg
tcacagtttgctgtggacatgcagacaacatcctccagaggactggtgtttcacacgggc
actaagaactcctttatggctctttatctttcaaaaggacgtctggtctttgcactgggg
acagatgggaaaaaattgaggatcaaaagcaaggagaaatgcaatgatgggaaatggcac
acggtggtgtttggccatgatggggaaaaggggcgcttggttgtggatggactgagggcc
cgggagggaagtttgcctggaaactccaccatcagcatcagagcgccagtttacctggga
tcacctccatcagggaaaccaaagagcctccccacaaacagctttgtgggatgcctgaag
aactttcagctggattcaaaacccttgtataccccttcttcaagcttcggggtgtcttcc
tgcttgggtggtcctttggagaaaggcatttatttctctgaagaaggaggtcatgtcgtc
ttggctcactctgtattgttggggccagaatttaagcttgttttcagcatccgcccaaga
agtctcactgggatcctaatacacatcggaagtcagcccgggaagcacttatgtgtttac
ctggaggcaggaaaggtcacggcctctatggacagtggggcaggtgggacctcaacgtcg
gtcacaccaaagcagtctctgtgtgatggacagtggcactcggtggcagtcaccataaaa
caacacatcctgcacctggaactggacacagacagtagctacacagctggacagatcccc
ttcccacctgccagcactcaagagccactacaccttggaggtgctccagccaatttgacg
acactgaggatccctgtgtggaaatcattctttggctgtctgaggaatattcatgtcaat
cacatccctgtccctgtcactgaagccttggaagtccaggggcctgtcagtctgaatggt
tgtcctgaccagtaa

DBGET integrated database retrieval system