KEGG   Homo sapiens (human): 391Help
Entry
391               CDS       T01001                                 

Gene name
RHOG, ARHG
Definition
ras homolog family member G
Orthology
K07863  
Ras homolog gene family, member G
Organism
hsa  Homo sapiens (human)
Pathway
Bacterial invasion of epithelial cells
Shigellosis
Salmonella infection
Class
Human Diseases; Infectious diseases; Salmonella infection [PATH:hsa05132]
Human Diseases; Infectious diseases; Shigellosis [PATH:hsa05131]
Human Diseases; Infectious diseases; Bacterial invasion of epithelial cells [PATH:hsa05100]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
11p15.5-p15.4
AA seq 191 aa AA seqDB search
MQSIKCVVVGDGAVGKTCLLICYTTNAFPKEYIPTVFDNYSAQSAVDGRTVNLNLWDTAG
QEEYDRLRTLSYPQTNVFVICFSIASPPSYENVRHKWHPEVCHHCPDVPILLVGTKKDLR
AQPDTLRRLKEQGQAPITPQQGQALAKQIHAVRYLECSALQQDGVKEVFAEAVRAVLNPT
PIKRGRSCILL
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgcagagcatcaagtgcgtggtggtgggtgatggggctgtgggcaagacgtgcctgctc
atctgctacacaactaacgctttccccaaagagtacatccccaccgtgttcgacaattac
agcgcgcagagcgcagttgacgggcgcacagtgaacctgaacctgtgggacactgcgggc
caggaggagtatgaccgcctccgtacactctcctaccctcagaccaacgttttcgtcatc
tgtttctccattgccagtccgccgtcctatgagaacgtgcggcacaagtggcatccagag
gtgtgccaccactgccctgatgtgcccatcctgctggtgggcaccaagaaggacctgaga
gcccagcctgacaccctacggcgcctcaaggagcagggccaggcgcccatcacaccgcag
cagggccaggcactggccaagcagatccacgctgtgcgctacctcgaatgctcagccctg
caacaggatggtgtcaaggaagtgttcgccgaggctgtccgggctgtgctcaaccccacg
ccgatcaagcgtgggcggtcctgcatcctcttgtga

DBGET integrated database retrieval system