KEGG   Homo sapiens (human): 391Help
Entry
391               CDS       T01001                                 

Gene name
RHOG, ARHG
Definition
(RefSeq) ras homolog family member G
  KO
K07863  Ras homolog gene family, member G
Organism
hsa  Homo sapiens (human)
Pathway
hsa05100  Bacterial invasion of epithelial cells
hsa05131  Shigellosis
hsa05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Infectious diseases
   05132 Salmonella infection
    391 (RHOG)
   05131 Shigellosis
    391 (RHOG)
   05100 Bacterial invasion of epithelial cells
    391 (RHOG)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   391 (RHOG)
  Exosomal proteins of other body fluids (saliva and urine)
   391 (RHOG)
  Exosomal proteins of colorectal cancer cells
   391 (RHOG)
  Exosomal proteins of bladder cancer cells
   391 (RHOG)
GTP-binding proteins [BR:hsa04031]
 Small (Monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    391 (RHOG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ras Roc Arf Gtr1_RagA
Motif
Other DBs
NCBI-GeneID: 391
NCBI-ProteinID: NP_001656
OMIM: 179505
HGNC: 672
Ensembl: ENSG00000177105
Vega: OTTHUMG00000012287
Pharos: P84095(Tbio)
UniProt: P84095 Q6ICQ8
Position
11p15.4
AA seq 191 aa AA seqDB search
MQSIKCVVVGDGAVGKTCLLICYTTNAFPKEYIPTVFDNYSAQSAVDGRTVNLNLWDTAG
QEEYDRLRTLSYPQTNVFVICFSIASPPSYENVRHKWHPEVCHHCPDVPILLVGTKKDLR
AQPDTLRRLKEQGQAPITPQQGQALAKQIHAVRYLECSALQQDGVKEVFAEAVRAVLNPT
PIKRGRSCILL
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgcagagcatcaagtgcgtggtggtgggtgatggggctgtgggcaagacgtgcctgctc
atctgctacacaactaacgctttccccaaagagtacatccccaccgtgttcgacaattac
agcgcgcagagcgcagttgacgggcgcacagtgaacctgaacctgtgggacactgcgggc
caggaggagtatgaccgcctccgtacactctcctaccctcagaccaacgttttcgtcatc
tgtttctccattgccagtccgccgtcctatgagaacgtgcggcacaagtggcatccagag
gtgtgccaccactgccctgatgtgcccatcctgctggtgggcaccaagaaggacctgaga
gcccagcctgacaccctacggcgcctcaaggagcagggccaggcgcccatcacaccgcag
cagggccaggcactggccaagcagatccacgctgtgcgctacctcgaatgctcagccctg
caacaggatggtgtcaaggaagtgttcgccgaggctgtccgggctgtgctcaaccccacg
ccgatcaagcgtgggcggtcctgcatcctcttgtga

DBGET integrated database retrieval system