KEGG   Homo sapiens (human): 391Help
Entry
391               CDS       T01001                                 

Gene name
RHOG, ARHG
Definition
ras homolog family member G
Orthology
K07863  
Ras homolog gene family, member G
Organism
hsa  Homo sapiens (human)
Pathway
Bacterial invasion of epithelial cells
Shigellosis
Salmonella infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Infectious diseases
   05132 Salmonella infection
    391 (RHOG)
   05131 Shigellosis
    391 (RHOG)
   05100 Bacterial invasion of epithelial cells
    391 (RHOG)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   391 (RHOG)
  Exosomal proteins of other body fluids (saliva and urine)
   391 (RHOG)
  Exosomal proteins of colorectal cancer cells
   391 (RHOG)
  Exosomal proteins of bladder cancer cells
   391 (RHOG)
GTP-binding proteins [BR:hsa04031]
 Small (Monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    391 (RHOG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
11p15.5-p15.4
AA seq 191 aa AA seqDB search
MQSIKCVVVGDGAVGKTCLLICYTTNAFPKEYIPTVFDNYSAQSAVDGRTVNLNLWDTAG
QEEYDRLRTLSYPQTNVFVICFSIASPPSYENVRHKWHPEVCHHCPDVPILLVGTKKDLR
AQPDTLRRLKEQGQAPITPQQGQALAKQIHAVRYLECSALQQDGVKEVFAEAVRAVLNPT
PIKRGRSCILL
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgcagagcatcaagtgcgtggtggtgggtgatggggctgtgggcaagacgtgcctgctc
atctgctacacaactaacgctttccccaaagagtacatccccaccgtgttcgacaattac
agcgcgcagagcgcagttgacgggcgcacagtgaacctgaacctgtgggacactgcgggc
caggaggagtatgaccgcctccgtacactctcctaccctcagaccaacgttttcgtcatc
tgtttctccattgccagtccgccgtcctatgagaacgtgcggcacaagtggcatccagag
gtgtgccaccactgccctgatgtgcccatcctgctggtgggcaccaagaaggacctgaga
gcccagcctgacaccctacggcgcctcaaggagcagggccaggcgcccatcacaccgcag
cagggccaggcactggccaagcagatccacgctgtgcgctacctcgaatgctcagccctg
caacaggatggtgtcaaggaagtgttcgccgaggctgtccgggctgtgctcaaccccacg
ccgatcaagcgtgggcggtcctgcatcctcttgtga

DBGET integrated database retrieval system