KEGG   Homo sapiens (human): 3910Help
Entry
3910              CDS       T01001                                 

Gene name
LAMA4, CMD1JJ, LAMA3, LAMA4*-1
Definition
laminin, alpha 4
Orthology
K06241  
laminin, alpha 4
Organism
hsa  Homo sapiens (human)
Pathway
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
African trypanosomiasis
Toxoplasmosis
Amoebiasis
Pathways in cancer
Small cell lung cancer
Class
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:hsa04151]
Environmental Information Processing; Signaling molecules and interaction; ECM-receptor interaction [PATH:hsa04512]
Cellular Processes; Cell communication; Focal adhesion [PATH:hsa04510]
Human Diseases; Cancers; Pathways in cancer [PATH:hsa05200]
Human Diseases; Cancers; Small cell lung cancer [PATH:hsa05222]
Human Diseases; Infectious diseases; Amoebiasis [PATH:hsa05146]
Human Diseases; Infectious diseases; Toxoplasmosis [PATH:hsa05145]
Human Diseases; Infectious diseases; African trypanosomiasis [PATH:hsa05143]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
6q21
AA seq 1823 aa AA seqDB search
MALSSAWRSVLPLWLLWSAACSRAASGDDNAFPFDIEGSSAVGRQDPPETSEPRVALGRL
PPAAEKCNAGFFHTLSGECVPCDCNGNSNECLDGSGYCVHCQRNTTGEHCEKCLDGYIGD
SIRGAPQFCQPCPCPLPHLANFAESCYRKNGAVRCICNENYAGPNCERCAPGYYGNPLLI
GSTCKKCDCSGNSDPNLIFEDCDEVTGQCRNCLRNTTGFKCERCAPGYYGDARIAKNCAV
CNCGGGPCDSVTGECLEEGFEPPTGMDCPTISCDKCVWDLTDDLRLAALSIEEGKSGVLS
VSSGAAAHRHVNEINATIYLLKTKLSERENQYALRKIQINNAENTMKSLLSDVEELVEKE
NQASRKGQLVQKESMDTINHASQLVEQAHDMRDKIQEINNKMLYYGEEHELSPKEISEKL
VLAQKMLEEIRSRQPFFTQRELVDEEADEAYELLSQAESWQRLHNETRTLFPVVLEQLDD
YNAKLSDLQEALDQALNYVRDAEDMNRATAARQRDHEKQQERVREQMEVVNMSLSTSADS
LTTPRLTLSELDDIIKNASGIYAEIDGAKSELQVKLSNLSNLSHDLVQEAIDHAQDLQQE
ANELSRKLHSSDMNGLVQKALDASNVYENIVNYVSEANETAEFALNTTDRIYDAVSGIDT
QIIYHKDESENLLNQARELQAKAESSSDEAVADTSRRVGGALARKSALKTRLSDAVKQLQ
AAERGDAQQRLGQSRLITEEANRTTMEVQQATAPMANNLTNWSQNLQHFDSSAYNTAVNS
ARDAVRNLTEVVPQLLDQLRTVEQKRPASNVSASIQRIRELIAQTRSVASKIQVSMMFDG
QSAVEVHSRTSMDDLKAFTSLSLYMKPPVKRPELTETADQFILYLGSKNAKKEYMGLAIK
NDNLVYVYNLGTKDVEIPLDSKPVSSWPAYFSIVKIERVGKHGKVFLTVPSLSSTAEEKF
IKKGEFSGDDSLLDLDPEDTVFYVGGVPSNFKLPTSLNLPGFVGCLELATLNNDVISLYN
FKHIYNMDPSTSVPCARDKLAFTQSRAASYFFDGSGYAVVRDITRRGKFGQVTRFDIEVR
TPADNGLILLMVNGSMFFRLEMRNGYLHVFYDFGFSGGPVHLEDTLKKAQINDAKYHEIS
IIYHNDKKMILVVDRRHVKSMDNEKMKIPFTDIYIGGAPPEILQSRALRAHLPLDINFRG
CMKGFQFQKKDFNLLEQTETLGVGYGCPEDSLISRRAYFNGQSFIASIQKISFFDGFEGG
FNFRTLQPNGLLFYYASGSDVFSISLDNGTVIMDVKGIKVQSVDKQYNDGLSHFVISSVS
PTRYELIVDKSRVGSKNPTKGKIEQTQASEKKFYFGGSPISAQYANFTGCISNAYFTRVD
RDVEVEDFQRYTEKVHTSLYECPIESSPLFLLHKKGKNLSKPKASQNKKGGKSKDAPSWD
PVALKLPERNTPRNSHCHLSNSPRAIEHAYQYGGTANSRQEFEHLKGDFGAKSQFSIRLR
TRSSHGMIFYVSDQEENDFMTLFLAHGRLVYMFNVGHKKLKIRSQEKYNDGLWHDVIFIR
ERSSGRLVIDGLRVLEESLPPTEATWKIKGPIYLGGVAPGKAVKNVQINSIYSFSGCLSN
LQLNGASITSASQTFSVTPCFEGPMETGTYFSTEGGYVVLDESFNIGLKFEIAFEVRPRS
SSGTLVHGHSVNGEYLNVHMKNGQVIVKVNNGIRDFSTSVTPKQSLCDGRWHRITVIRDS
NVVQLDVDSEVNHVVGPLNPKPIDHREPVFVGGVPESLLTPRLAPSKPFTGCIRHFVIDG
HPVSFSKAALVSGAVSINSCPAA
NT seq 5472 nt NT seq  +upstreamnt  +downstreamnt
atggctttgagctcagcctggcgctcggttctgcctctgtggctcctctggagcgctgcc
tgctcccgcgccgcgtccggggacgacaacgcttttccttttgacattgaagggagctca
gcggttggcaggcaagacccgcctgagacgagcgaaccccgcgtggctctgggacgcctg
ccgcctgcggccgagaaatgcaatgctggattctttcacaccctgtcgggagaatgtgtg
ccctgcgactgtaatggcaattccaacgagtgtttggacggctcaggatactgtgtgcac
tgccagcggaacacaacaggagagcactgtgaaaagtgtctggatggttatatcggagat
tccatcaggggagcaccccaattctgccagccgtgcccctgtcccctgccccacttggcc
aattttgcagaatcctgctataggaaaaatggagctgttcggtgcatttgtaacgaaaat
tatgctggacctaactgtgaaagatgtgctcccggttactatggaaaccccttactcatt
ggaagcacctgtaagaaatgtgactgcagtggaaattcagatcccaacctgatctttgaa
gattgtgatgaagtcactggccagtgtaggaattgcttacgcaacaccaccggattcaag
tgtgaacgttgcgctcctggctactatggggacgccaggatagccaagaactgtgcagtg
tgcaactgcgggggaggcccatgtgacagtgtaaccggagaatgcttggaagaaggtttt
gaaccccctacaggcatggactgcccaaccataagctgtgataagtgcgtctgggacctg
actgatgacctgcggttagcagcgctctccatcgaggaaggcaaatccggggtgctgagc
gtatcctctggggccgccgctcataggcacgtgaatgaaatcaacgccaccatctacctc
ctcaaaacaaaattgtcagaaagagaaaaccaatacgccctaagaaagatacaaatcaac
aatgctgagaacacgatgaaaagccttctgtctgacgtagaggaattagttgaaaaggaa
aatcaagcctccagaaaaggacaacttgttcagaaggaaagcatggacaccattaaccac
gcaagtcagctggtagagcaagcccatgatatgagggataaaatccaagagatcaacaac
aagatgctctattatggggaagagcatgaacttagccccaaggaaatctctgagaagctg
gtgttggcccagaagatgcttgaagagattagaagccgtcaaccatttttcacccaacgg
gagctcgtggatgaggaggcagatgaggcttacgaactactgagccaggctgagagctgg
cagcggctgcacaatgagacccgcactctgtttcctgtcgtcctggagcagctggatgac
tacaatgctaagttgtcagatctccaggaagcacttgaccaggcccttaactatgtcagg
gatgccgaagacatgaacagggccacagcagccaggcagcgggaccatgagaaacaacag
gaaagagtgagggaacaaatggaagtggtgaacatgtctctgagcacatctgcggactct
ctgacaacacctcgtctaactctttcagaacttgatgatataataaagaatgcgtcaggg
atttatgcagaaatagatggagccaaaagtgaactacaagtaaaactatctaacctaagt
aacctcagccatgatttagtccaagaagctattgaccatgcacaggaccttcaacaagaa
gctaatgaattgagcaggaagttgcacagttcagatatgaacgggctggtacagaaggct
ttggatgcatcaaatgtctatgaaaatattgttaattatgttagtgaagccaatgaaaca
gcagaatttgctttgaacaccactgaccgaatttatgatgcggtgagtgggattgatact
caaatcatttaccataaagatgaaagtgagaacctcctcaatcaagccagagaactgcaa
gcaaaggcagagtctagcagtgatgaagcagtggctgacactagcaggcgtgtgggtgga
gccctagcaaggaaaagtgcccttaaaaccagactcagtgatgccgttaagcaactacaa
gcagcagagagaggggatgcccagcagcgcctggggcagtctagactgatcaccgaggaa
gccaacaggacgacgatggaggtgcagcaggccactgcccccatggccaacaatctaacc
aactggtcacagaatcttcaacattttgactcttctgcttacaacactgcagtgaactct
gctagggatgcagtaagaaatctgaccgaggttgtccctcagctcctggatcagcttcgt
acggttgagcagaagcgacctgcaagcaacgtttctgccagcatccagaggatccgagag
ctcattgctcagaccagaagtgttgccagcaagatccaagtctccatgatgtttgatggc
cagtcagctgtggaagtgcactcgagaaccagtatggatgacttaaaggccttcacgtct
ctgagcctgtacatgaaaccccctgtgaagcggccggaactgaccgagactgcagatcag
tttatcctgtacctcggaagcaaaaacgccaaaaaagagtatatgggtcttgcaatcaaa
aatgataatctggtatacgtctataatttgggaactaaagatgtggagattcccctggac
tccaagcccgtcagttcctggcctgcttacttcagcattgtcaagattgaaagggtggga
aaacatggaaaggtgtttttaacagtcccgagtctaagtagcacagcagaggaaaagttc
attaaaaagggggaattttcgggagatgactctctgctggacctggaccctgaggacaca
gtgttttatgttggtggagtgccttccaacttcaagctccctaccagcttaaacctgcct
ggctttgttggctgcctggaactggccactttgaataatgatgtgatcagcttgtacaac
tttaagcacatctataatatggacccctccacatcagtgccatgtgcccgagataagctg
gccttcactcagagtcgggctgccagttacttcttcgatggctccggttatgccgtggtg
agagacatcacaaggagagggaaatttggtcaggtgactcgctttgacatagaagttcga
acaccagctgacaacggccttattctcctgatggtcaatggaagtatgtttttcagactg
gaaatgcgcaatggttacctacatgtgttctatgattttggattcagcggtggccctgtg
catcttgaagatacgttaaagaaagctcaaattaatgatgcaaaataccatgagatctca
atcatttaccacaatgataagaaaatgatcttggtagttgacagaaggcatgtcaagagc
atggataatgaaaagatgaaaataccttttacagatatatacattggaggagctcctcca
gaaatcttacaatccagggccctcagagcacaccttcccctagatatcaacttcagagga
tgcatgaagggcttccagttccaaaagaaggacttcaatttactggagcagacagaaacc
ctgggagttggttatggatgcccagaagactcacttatatctcgcagagcatatttcaat
ggacagagcttcattgcttcaattcagaaaatatctttctttgatggctttgaaggaggt
tttaatttccgaacattacaaccaaatgggttactattctattatgcttcagggtcagac
gtgttctccatctcactggataatggtactgtcatcatggatgtaaagggaatcaaagtt
cagtcagtagataagcagtacaatgatgggctgtcccacttcgtcattagctctgtctca
cccacaagatatgaactgatagtagataaaagcagagttgggagtaagaatcctaccaaa
gggaaaatagaacagacacaagcaagtgaaaagaagttttacttcggtggctcaccaatc
agtgctcagtatgctaatttcactggctgcataagtaatgcctactttaccagggtggat
agagatgtggaggttgaagatttccaacggtatactgaaaaggtccacacttctctttat
gagtgtcccattgagtcttcaccattgtttctcctccataaaaaaggaaaaaatttatcc
aagcctaaagcaagtcagaataaaaagggagggaaaagtaaagatgcaccttcatgggat
cctgttgctctgaaactcccagagcggaatactccaagaaactctcattgccacctttcc
aacagccctagagcaatagagcacgcctatcaatatggaggaacagccaacagccgccaa
gagtttgaacacttaaaaggagattttggtgccaaatctcagttttccattcgtctgaga
actcgttcctcccatggcatgatcttctatgtctcagatcaagaagagaatgacttcatg
actctatttttggcccatggccgcttggtttacatgtttaatgttggtcacaaaaaactg
aagattagaagccaggagaaatacaatgatggcctgtggcatgatgtgatatttattcga
gaaaggagcagtggccgactggtaattgatggtctccgagtcctagaagaaagtcttcct
cctactgaagctacctggaaaatcaagggtcccatttatttgggaggtgtggctcctgga
aaggctgtgaaaaatgttcagattaactccatctacagttttagtggctgtctcagcaat
ctccagctcaatggggcctccatcacctctgcttctcagacattcagtgtgaccccttgc
tttgaaggccccatggaaacaggaacttacttttcaacagaaggaggatacgtggttcta
gatgaatctttcaatattggattgaagtttgaaattgcatttgaagtccgtcccagaagc
agttccggaaccctggtccacggccacagtgtcaatggggagtacctaaatgttcacatg
aaaaatggacaggtcatagtgaaagtcaataatggcatcagagatttttccacctcagtt
acacccaagcagagtctctgtgatggcagatggcacagaattacagttattagagattct
aatgtggttcagttggatgtggactctgaagtgaaccatgtggttggacccctgaatcca
aaaccaattgatcacagggagcctgtgtttgttggaggtgttccagaatctctactgaca
ccacgcttggcccccagcaaacccttcacaggctgcatacgccactttgtgattgatgga
cacccagtgagcttcagtaaagcagccctggtcagcggcgccgtaagcatcaactcctgt
ccagcagcctga

DBGET integrated database retrieval system