KEGG   Homo sapiens (human): 3910Help
Entry
3910              CDS       T01001                                 

Gene name
LAMA4, CMD1JJ, LAMA3, LAMA4*-1
Definition
laminin, alpha 4
Orthology
K06241  
laminin, alpha 4
Organism
hsa  Homo sapiens (human)
Pathway
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
African trypanosomiasis
Toxoplasmosis
Amoebiasis
Pathways in cancer
Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    3910 (LAMA4)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    3910 (LAMA4)
 Cellular Processes
  Cellular commiunity
   04510 Focal adhesion
    3910 (LAMA4)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    3910 (LAMA4)
   05222 Small cell lung cancer
    3910 (LAMA4)
  Infectious diseases
   05146 Amoebiasis
    3910 (LAMA4)
   05145 Toxoplasmosis
    3910 (LAMA4)
   05143 African trypanosomiasis
    3910 (LAMA4)
Cell adhesion molecules and their ligands [BR:hsa04516]
 2. Integrin Family
  Beta1 integrins
   VLA-6
    ITGB1; integrin beta 1 [KO:K05719]
     Laminin-8 Extracellular matrix (ECM) components
      3910 (LAMA4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
6q21
AA seq 1823 aa AA seqDB search
MALSSAWRSVLPLWLLWSAACSRAASGDDNAFPFDIEGSSAVGRQDPPETSEPRVALGRL
PPAAEKCNAGFFHTLSGECVPCDCNGNSNECLDGSGYCVHCQRNTTGEHCEKCLDGYIGD
SIRGAPQFCQPCPCPLPHLANFAESCYRKNGAVRCICNENYAGPNCERCAPGYYGNPLLI
GSTCKKCDCSGNSDPNLIFEDCDEVTGQCRNCLRNTTGFKCERCAPGYYGDARIAKNCAV
CNCGGGPCDSVTGECLEEGFEPPTGMDCPTISCDKCVWDLTDDLRLAALSIEEGKSGVLS
VSSGAAAHRHVNEINATIYLLKTKLSERENQYALRKIQINNAENTMKSLLSDVEELVEKE
NQASRKGQLVQKESMDTINHASQLVEQAHDMRDKIQEINNKMLYYGEEHELSPKEISEKL
VLAQKMLEEIRSRQPFFTQRELVDEEADEAYELLSQAESWQRLHNETRTLFPVVLEQLDD
YNAKLSDLQEALDQALNYVRDAEDMNRATAARQRDHEKQQERVREQMEVVNMSLSTSADS
LTTPRLTLSELDDIIKNASGIYAEIDGAKSELQVKLSNLSNLSHDLVQEAIDHAQDLQQE
ANELSRKLHSSDMNGLVQKALDASNVYENIVNYVSEANETAEFALNTTDRIYDAVSGIDT
QIIYHKDESENLLNQARELQAKAESSSDEAVADTSRRVGGALARKSALKTRLSDAVKQLQ
AAERGDAQQRLGQSRLITEEANRTTMEVQQATAPMANNLTNWSQNLQHFDSSAYNTAVNS
ARDAVRNLTEVVPQLLDQLRTVEQKRPASNVSASIQRIRELIAQTRSVASKIQVSMMFDG
QSAVEVHSRTSMDDLKAFTSLSLYMKPPVKRPELTETADQFILYLGSKNAKKEYMGLAIK
NDNLVYVYNLGTKDVEIPLDSKPVSSWPAYFSIVKIERVGKHGKVFLTVPSLSSTAEEKF
IKKGEFSGDDSLLDLDPEDTVFYVGGVPSNFKLPTSLNLPGFVGCLELATLNNDVISLYN
FKHIYNMDPSTSVPCARDKLAFTQSRAASYFFDGSGYAVVRDITRRGKFGQVTRFDIEVR
TPADNGLILLMVNGSMFFRLEMRNGYLHVFYDFGFSGGPVHLEDTLKKAQINDAKYHEIS
IIYHNDKKMILVVDRRHVKSMDNEKMKIPFTDIYIGGAPPEILQSRALRAHLPLDINFRG
CMKGFQFQKKDFNLLEQTETLGVGYGCPEDSLISRRAYFNGQSFIASIQKISFFDGFEGG
FNFRTLQPNGLLFYYASGSDVFSISLDNGTVIMDVKGIKVQSVDKQYNDGLSHFVISSVS
PTRYELIVDKSRVGSKNPTKGKIEQTQASEKKFYFGGSPISAQYANFTGCISNAYFTRVD
RDVEVEDFQRYTEKVHTSLYECPIESSPLFLLHKKGKNLSKPKASQNKKGGKSKDAPSWD
PVALKLPERNTPRNSHCHLSNSPRAIEHAYQYGGTANSRQEFEHLKGDFGAKSQFSIRLR
TRSSHGMIFYVSDQEENDFMTLFLAHGRLVYMFNVGHKKLKIRSQEKYNDGLWHDVIFIR
ERSSGRLVIDGLRVLEESLPPTEATWKIKGPIYLGGVAPGKAVKNVQINSIYSFSGCLSN
LQLNGASITSASQTFSVTPCFEGPMETGTYFSTEGGYVVLDESFNIGLKFEIAFEVRPRS
SSGTLVHGHSVNGEYLNVHMKNGQVIVKVNNGIRDFSTSVTPKQSLCDGRWHRITVIRDS
NVVQLDVDSEVNHVVGPLNPKPIDHREPVFVGGVPESLLTPRLAPSKPFTGCIRHFVIDG
HPVSFSKAALVSGAVSINSCPAA
NT seq 5472 nt NT seq  +upstreamnt  +downstreamnt
atggctttgagctcagcctggcgctcggttctgcctctgtggctcctctggagcgctgcc
tgctcccgcgccgcgtccggggacgacaacgcttttccttttgacattgaagggagctca
gcggttggcaggcaagacccgcctgagacgagcgaaccccgcgtggctctgggacgcctg
ccgcctgcggccgagaaatgcaatgctggattctttcacaccctgtcgggagaatgtgtg
ccctgcgactgtaatggcaattccaacgagtgtttggacggctcaggatactgtgtgcac
tgccagcggaacacaacaggagagcactgtgaaaagtgtctggatggttatatcggagat
tccatcaggggagcaccccaattctgccagccgtgcccctgtcccctgccccacttggcc
aattttgcagaatcctgctataggaaaaatggagctgttcggtgcatttgtaacgaaaat
tatgctggacctaactgtgaaagatgtgctcccggttactatggaaaccccttactcatt
ggaagcacctgtaagaaatgtgactgcagtggaaattcagatcccaacctgatctttgaa
gattgtgatgaagtcactggccagtgtaggaattgcttacgcaacaccaccggattcaag
tgtgaacgttgcgctcctggctactatggggacgccaggatagccaagaactgtgcagtg
tgcaactgcgggggaggcccatgtgacagtgtaaccggagaatgcttggaagaaggtttt
gaaccccctacaggcatggactgcccaaccataagctgtgataagtgcgtctgggacctg
actgatgacctgcggttagcagcgctctccatcgaggaaggcaaatccggggtgctgagc
gtatcctctggggccgccgctcataggcacgtgaatgaaatcaacgccaccatctacctc
ctcaaaacaaaattgtcagaaagagaaaaccaatacgccctaagaaagatacaaatcaac
aatgctgagaacacgatgaaaagccttctgtctgacgtagaggaattagttgaaaaggaa
aatcaagcctccagaaaaggacaacttgttcagaaggaaagcatggacaccattaaccac
gcaagtcagctggtagagcaagcccatgatatgagggataaaatccaagagatcaacaac
aagatgctctattatggggaagagcatgaacttagccccaaggaaatctctgagaagctg
gtgttggcccagaagatgcttgaagagattagaagccgtcaaccatttttcacccaacgg
gagctcgtggatgaggaggcagatgaggcttacgaactactgagccaggctgagagctgg
cagcggctgcacaatgagacccgcactctgtttcctgtcgtcctggagcagctggatgac
tacaatgctaagttgtcagatctccaggaagcacttgaccaggcccttaactatgtcagg
gatgccgaagacatgaacagggccacagcagccaggcagcgggaccatgagaaacaacag
gaaagagtgagggaacaaatggaagtggtgaacatgtctctgagcacatctgcggactct
ctgacaacacctcgtctaactctttcagaacttgatgatataataaagaatgcgtcaggg
atttatgcagaaatagatggagccaaaagtgaactacaagtaaaactatctaacctaagt
aacctcagccatgatttagtccaagaagctattgaccatgcacaggaccttcaacaagaa
gctaatgaattgagcaggaagttgcacagttcagatatgaacgggctggtacagaaggct
ttggatgcatcaaatgtctatgaaaatattgttaattatgttagtgaagccaatgaaaca
gcagaatttgctttgaacaccactgaccgaatttatgatgcggtgagtgggattgatact
caaatcatttaccataaagatgaaagtgagaacctcctcaatcaagccagagaactgcaa
gcaaaggcagagtctagcagtgatgaagcagtggctgacactagcaggcgtgtgggtgga
gccctagcaaggaaaagtgcccttaaaaccagactcagtgatgccgttaagcaactacaa
gcagcagagagaggggatgcccagcagcgcctggggcagtctagactgatcaccgaggaa
gccaacaggacgacgatggaggtgcagcaggccactgcccccatggccaacaatctaacc
aactggtcacagaatcttcaacattttgactcttctgcttacaacactgcagtgaactct
gctagggatgcagtaagaaatctgaccgaggttgtccctcagctcctggatcagcttcgt
acggttgagcagaagcgacctgcaagcaacgtttctgccagcatccagaggatccgagag
ctcattgctcagaccagaagtgttgccagcaagatccaagtctccatgatgtttgatggc
cagtcagctgtggaagtgcactcgagaaccagtatggatgacttaaaggccttcacgtct
ctgagcctgtacatgaaaccccctgtgaagcggccggaactgaccgagactgcagatcag
tttatcctgtacctcggaagcaaaaacgccaaaaaagagtatatgggtcttgcaatcaaa
aatgataatctggtatacgtctataatttgggaactaaagatgtggagattcccctggac
tccaagcccgtcagttcctggcctgcttacttcagcattgtcaagattgaaagggtggga
aaacatggaaaggtgtttttaacagtcccgagtctaagtagcacagcagaggaaaagttc
attaaaaagggggaattttcgggagatgactctctgctggacctggaccctgaggacaca
gtgttttatgttggtggagtgccttccaacttcaagctccctaccagcttaaacctgcct
ggctttgttggctgcctggaactggccactttgaataatgatgtgatcagcttgtacaac
tttaagcacatctataatatggacccctccacatcagtgccatgtgcccgagataagctg
gccttcactcagagtcgggctgccagttacttcttcgatggctccggttatgccgtggtg
agagacatcacaaggagagggaaatttggtcaggtgactcgctttgacatagaagttcga
acaccagctgacaacggccttattctcctgatggtcaatggaagtatgtttttcagactg
gaaatgcgcaatggttacctacatgtgttctatgattttggattcagcggtggccctgtg
catcttgaagatacgttaaagaaagctcaaattaatgatgcaaaataccatgagatctca
atcatttaccacaatgataagaaaatgatcttggtagttgacagaaggcatgtcaagagc
atggataatgaaaagatgaaaataccttttacagatatatacattggaggagctcctcca
gaaatcttacaatccagggccctcagagcacaccttcccctagatatcaacttcagagga
tgcatgaagggcttccagttccaaaagaaggacttcaatttactggagcagacagaaacc
ctgggagttggttatggatgcccagaagactcacttatatctcgcagagcatatttcaat
ggacagagcttcattgcttcaattcagaaaatatctttctttgatggctttgaaggaggt
tttaatttccgaacattacaaccaaatgggttactattctattatgcttcagggtcagac
gtgttctccatctcactggataatggtactgtcatcatggatgtaaagggaatcaaagtt
cagtcagtagataagcagtacaatgatgggctgtcccacttcgtcattagctctgtctca
cccacaagatatgaactgatagtagataaaagcagagttgggagtaagaatcctaccaaa
gggaaaatagaacagacacaagcaagtgaaaagaagttttacttcggtggctcaccaatc
agtgctcagtatgctaatttcactggctgcataagtaatgcctactttaccagggtggat
agagatgtggaggttgaagatttccaacggtatactgaaaaggtccacacttctctttat
gagtgtcccattgagtcttcaccattgtttctcctccataaaaaaggaaaaaatttatcc
aagcctaaagcaagtcagaataaaaagggagggaaaagtaaagatgcaccttcatgggat
cctgttgctctgaaactcccagagcggaatactccaagaaactctcattgccacctttcc
aacagccctagagcaatagagcacgcctatcaatatggaggaacagccaacagccgccaa
gagtttgaacacttaaaaggagattttggtgccaaatctcagttttccattcgtctgaga
actcgttcctcccatggcatgatcttctatgtctcagatcaagaagagaatgacttcatg
actctatttttggcccatggccgcttggtttacatgtttaatgttggtcacaaaaaactg
aagattagaagccaggagaaatacaatgatggcctgtggcatgatgtgatatttattcga
gaaaggagcagtggccgactggtaattgatggtctccgagtcctagaagaaagtcttcct
cctactgaagctacctggaaaatcaagggtcccatttatttgggaggtgtggctcctgga
aaggctgtgaaaaatgttcagattaactccatctacagttttagtggctgtctcagcaat
ctccagctcaatggggcctccatcacctctgcttctcagacattcagtgtgaccccttgc
tttgaaggccccatggaaacaggaacttacttttcaacagaaggaggatacgtggttcta
gatgaatctttcaatattggattgaagtttgaaattgcatttgaagtccgtcccagaagc
agttccggaaccctggtccacggccacagtgtcaatggggagtacctaaatgttcacatg
aaaaatggacaggtcatagtgaaagtcaataatggcatcagagatttttccacctcagtt
acacccaagcagagtctctgtgatggcagatggcacagaattacagttattagagattct
aatgtggttcagttggatgtggactctgaagtgaaccatgtggttggacccctgaatcca
aaaccaattgatcacagggagcctgtgtttgttggaggtgttccagaatctctactgaca
ccacgcttggcccccagcaaacccttcacaggctgcatacgccactttgtgattgatgga
cacccagtgagcttcagtaaagcagccctggtcagcggcgccgtaagcatcaactcctgt
ccagcagcctga

DBGET integrated database retrieval system