KEGG   Homo sapiens (human): 3911Help
Entry
3911              CDS       T01001                                 

Gene name
LAMA5
Definition
laminin, alpha 5
Orthology
K06240  
laminin, alpha 3/5
Organism
hsa  Homo sapiens (human)
Pathway
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Toxoplasmosis
Amoebiasis
Pathways in cancer
Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    3911 (LAMA5)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    3911 (LAMA5)
 Cellular Processes
  Cellular commiunity
   04510 Focal adhesion
    3911 (LAMA5)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    3911 (LAMA5)
   05222 Small cell lung cancer
    3911 (LAMA5)
  Infectious diseases
   05146 Amoebiasis
    3911 (LAMA5)
   05145 Toxoplasmosis
    3911 (LAMA5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
20q13.2-q13.3
AA seq 3695 aa AA seqDB search
MAKRLCAGSALCVRGPRGPAPLLLVGLALLGAARAREEAGGGFSLHPPYFNLAEGARIAA
SATCGEEAPARGSPRPTEDLYCKLVGGPVAGGDPNQTIRGQYCDICTAANSNKAHPASNA
IDGTERWWQSPPLSRGLEYNEVNVTLDLGQVFHVAYVLIKFANSPRPDLWVLERSMDFGR
TYQPWQFFASSKRDCLERFGPQTLERITRDDAAICTTEYSRIVPLENGEIVVSLVNGRPG
AMNFSYSPLLREFTKATNVRLRFLRTNTLLGHLMGKALRDPTVTRRYYYSIKDISIGGRC
VCHGHADACDAKDPTDPFRLQCTCQHNTCGGTCDRCCPGFNQQPWKPATANSANECQSCN
CYGHATDCYYDPEVDRRRASQSLDGTYQGGGVCIDCQHHTTGVNCERCLPGFYRSPNHPL
DSPHVCRRCNCESDFTDGTCEDLTGRCYCRPNFSGERCDVCAEGFTGFPSCYPTPSSSND
TREQVLPAGQIVNCDCSAAGTQGNACRKDPRVGRCLCKPNFQGTHCELCAPGFYGPGCQP
CQCSSPGVADDRCDPDTGQCRCRVGFEGATCDRCAPGYFHFPLCQLCGCSPAGTLPEGCD
EAGRCLCQPEFAGPHCDRCRPGYHGFPNCQACTCDPRGALDQLCGAGGLCRCRPGYTGTA
CQECSPGFHGFPSCVPCHCSAEGSLHAACDPRSGQCSCRPRVTGLRCDTCVPGAYNFPYC
EAGSCHPAGLAPVDPALPEAQVPCMCRAHVEGPSCDRCKPGFWGLSPSNPEGCTRCSCDL
RGTLGGVAECQPGTGQCFCKPHVCGQACASCKDGFFGLDQADYFGCRSCRCDIGGALGQS
CEPRTGVCRCRPNTQGPTCSEPARDHYLPDLHHLRLELEEAATPEGHAVRFGFNPLEFEN
FSWRGYAQMAPVQPRIVARLNLTSPDLFWLVFRYVNRGAMSVSGRVSVREEGRSATCANC
TAQSQPVAFPPSTEPAFITVPQRGFGEPFVLNPGTWALRVEAEGVLLDYVVLLPSAYYEA
ALLQLRVTEACTYRPSAQQSGDNCLLYTHLPLDGFPSAAGLEALCRQDNSLPRPCPTEQL
SPSHPPLITCTGSDVDVQLQVAVPQPGRYALVVEYANEDARQEVGVAVHTPQRAPQQGLL
SLHPCLYSTLCRGTARDTQDHLAVFHLDSEASVRLTAEQARFFLHGVTLVPIEEFSPEFV
EPRVSCISSHGAFGPNSAACLPSRFPKPPQPIILRDCQVIPLPPGLPLTHAQDLTPAMSP
AGPRPRPPTAVDPDAEPTLLREPQATVVFTTHVPTLGRYAFLLHGYQPAHPTFPVEVLIN
AGRVWQGHANASFCPHGYGCRTLVVCEGQALLDVTHSELTVTVRVPKGRWLWLDYVLVVP
ENVYSFGYLREEPLDKSYDFISHCAAQGYHISPSSSSLFCRNAAASLSLFYNNGARPCGC
HEVGATGPTCEPFGGQCPCHAHVIGRDCSRCATGYWGFPNCRPCDCGARLCDELTGQCIC
PPRTIPPDCLLCQPQTFGCHPLVGCEECNCSGPGIQELTDPTCDTDSGQCKCRPNVTGRR
CDTCSPGFHGYPRCRPCDCHEAGTAPGVCDPLTGQCYCKENVQGPKCDQCSLGTFSLDAA
NPKGCTRCFCFGATERCRSSSYTRQEFVDMEGWVLLSTDRQVVPHERQPGTEMLRADLRH
VPEAVPEAFPELYWQAPPSYLGDRVSSYGGTLRYELHSETQRGDVFVPMESRPDVVLQGN
QMSITFLEPAYPTPGHVHRGQLQLVEGNFRHTETRNTVSREELMMVLASLEQLQIRALFS
QISSAVFLRRVALEVASPAGQGALASNVELCLCPASYRGDSCQECAPGFYRDVKGLFLGR
CVPCQCHGHSDRCLPGSGVCVDCQHNTEGAHCERCQAGFVSSRDDPSAPCVSCPCPLSVP
SNNFAEGCVLRGGRTQCLCKPGYAGASCERCAPGFFGNPLVLGSSCQPCDCSGNGDPNLL
FSDCDPLTGACRGCLRHTTGPRCEICAPGFYGNALLPGNCTRCDCTPCGTEACDPHSGHC
LCKAGVTGRRCDRCQEGHFGFDGCGGCRPCACGPAAEGSECHPQSGQCHCRPGTMGPQCR
ECAPGYWGLPEQGCRRCQCPGGRCDPHTGRCNCPPGLSGERCDTCSQQHQVPVPGGPVGH
SIHCEVCDHCVVLLLDDLERAGALLPAIHEQLRGINASSMAWARLHRLNASIADLQSQLR
SPLGPRHETAQQLEVLEQQSTSLGQDARRLGGQAVGTRDQASQLLAGTEATLGHAKTLLA
AIRAVDRTLSELMSQTGHLGLANASAPSGEQLLRTLAEVERLLWEMRARDLGAPQAAAEA
ELAAAQRLLARVQEQLSSLWEENQALATQTRDRLAQHEAGLMDLREALNRAVDATREAQE
LNSRNQERLEEALQRKQELSRDNATLQATLHAARDTLASVFRLLHSLDQAKEELERLAAS
LDGARTPLLQRMQTFSPAGSKLRLVEAAEAHAQQLGQLALNLSSIILDVNQDRLTQRAIE
ASNAYSRILQAVQAAEDAAGQALQQADHTWATVVRQGLVDRAQQLLANSTALEEAMLQEQ
QRLGLVWAALQGARTQLRDVRAKKDQLEAHIQAAQAMLAMDTDETSKKIAHAKAVAAEAQ
DTATRVQSQLQAMQENVERWQGQYEGLRGQDLGQAVLDAGHSVSTLEKTLPQLLAKLSIL
ENRGVHNASLALSASIGRVRELIAQARGAASKVKVPMKFNGRSGVQLRTPRDLADLAAYT
ALKFYLQGPEPEPGQGTEDRFVMYMGSRQATGDYMGVSLRDKKVHWVYQLGEAGPAVLSI
DEDIGEQFAAVSLDRTLQFGHMSVTVERQMIQETKGDTVAPGAEGLLNLRPDDFVFYVGG
YPSTFTPPPLLRFPGYRGCIEMDTLNEEVVSLYNFERTFQLDTAVDRPCARSKSTGDPWL
TDGSYLDGTGFARISFDSQISTTKRFEQELRLVSYSGVLFFLKQQSQFLCLAVQEGSLVL
LYDFGAGLKKAVPLQPPPPLTSASKAIQVFLLGGSRKRVLVRVERATVYSVEQDNDLELA
DAYYLGGVPPDQLPPSLRRLFPTGGSVRGCVKGIKALGKYVDLKRLNTTGVSAGCTADLL
VGRAMTFHGHGFLRLALSNVAPLTGNVYSGFGFHSAQDSALLYYRASPDGLCQVSLQQGR
VSLQLLRTEVKTQAGFADGAPHYVAFYSNATGVWLYVDDQLQQMKPHRGPPPELQPQPEG
PPRLLLGGLPESGTIYNFSGCISNVFVQRLLGPQRVFDLQQNLGSVNVSTGCAPALQAQT
PGLGPRGLQATARKASRRSRQPARHPACMLPPHLRTTRDSYQFGGSLSSHLEFVGILARH
RNWPSLSMHVLPRSSRGLLLFTARLRPGSPSLALFLSNGHFVAQMEGLGTRLRAQSRQRS
RPGRWHKVSVRWEKNRILLVTDGARAWSQEGPHRQHQGAEHPQPHTLFVGGLPASSHSSK
LPVTVGFSGCVKRLRLHGRPLGAPTRMAGVTPCILGPLEAGLFFPGSGGVITLDLPGATL
PDVGLELEVRPLAVTGLIFHLGQARTPPYLQLQVTEKQVLLRADDGAGEFSTSVTRPSVL
CDGQWHRLAVMKSGNVLRLEVDAQSNHTVGPLLAAAAGAPAPLYLGGLPEPMAVQPWPPA
YCGCMRRLAVNRSPVAMTRSVEVHGAVGASGCPAA
NT seq 11088 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagcggctctgcgcggggagcgcactgtgtgttcgcggcccccggggccccgcg
ccgctgctgctggtcgggctggcgctgctgggcgcggcgcgggcgcgggaggaggcgggc
ggcggcttcagcctgcacccgccctacttcaacctggccgagggcgcccgcatcgccgcc
tccgcgacctgcggagaggaggccccggcgcgcggctccccgcgccccaccgaggacctt
tactgcaagctggtagggggccccgtggccggcggcgaccccaaccagaccatccggggc
cagtactgtgacatctgcacggctgccaacagcaacaaggcacaccccgcgagcaatgcc
atcgatggcacggagcgctggtggcagagtccaccgctgtcccgcggcctggagtacaac
gaggtcaacgtcaccctggacctgggccaggtcttccacgtggcctacgtcctcatcaag
tttgccaactcaccccggccggacctctgggtgctggagcggtccatggacttcggccgc
acctaccagccctggcagttctttgcctcctccaagagggactgtctggagcggttcggg
ccacagacgctggagcgcatcacacgggacgacgcggccatctgcaccaccgagtactca
cgcatcgtgcccctggagaacggagagatcgtggtgtccctggtgaacggacgtccgggc
gccatgaatttctcctactcgccgctgctacgtgagttcaccaaggccaccaacgtccgc
ctgcgcttcctgcgtaccaacacgctgctgggccatctcatggggaaggcgctgcgggac
cccacggtcacccgccggtattattacagcatcaaggatatcagcatcggaggccgctgt
gtctgccacggccacgcggatgcctgcgatgccaaagaccccacggacccgttcaggctg
cagtgcacctgccagcacaacacctgcgggggcacctgcgaccgctgctgccccggcttc
aatcagcagccgtggaagcctgcgactgccaacagtgccaacgagtgccagtcctgtaac
tgctacggccatgccaccgactgttactacgaccctgaggtggaccggcgccgcgccagc
cagagcctggatggcacctatcagggtgggggtgtctgtatcgactgccagcaccacacc
accggcgtcaactgtgagcgctgcctgcccggcttctaccgctctcccaaccaccctctc
gactcgccccacgtctgccgccgctgcaactgcgagtccgacttcacggatggcacctgc
gaggacctgacgggtcgatgctactgccggcccaacttctctggggagcggtgtgacgtg
tgtgccgagggcttcacgggcttcccaagctgctacccgacgccctcgtcctccaatgac
accagggagcaggtgctgccagccggccagattgtgaattgtgactgcagcgcggcaggg
acccagggcaacgcctgccggaaggacccaagggtgggacgctgtctgtgcaaacccaac
ttccaaggcacccattgtgagctctgcgcgccagggttctacggccccggctgccagccc
tgccagtgttccagccctggagtggccgatgaccgctgtgaccctgacacaggccagtgc
aggtgccgagtgggcttcgagggggccacatgtgatcgctgtgcccccggctactttcac
ttccctctctgccagttgtgtggctgcagccctgcaggaaccttgcccgagggctgcgat
gaggccggccgctgcctatgccagcctgagtttgctggacctcattgtgaccggtgccgc
cctggctaccatggtttccccaactgccaagcatgcacctgcgaccctcggggagccctg
gaccagctctgtggggcgggaggtttgtgccgctgccgccccggctacacaggcactgcc
tgccaggaatgcagccccggctttcacggcttccccagctgtgtcccctgccactgctct
gctgaaggctccctgcacgcagcctgtgacccccggagtgggcagtgcagctgccggccc
cgtgtgacggggctgcggtgtgacacatgtgtgcccggtgcctacaacttcccctactgc
gaagctggctcttgccaccctgccggtctggccccagtggatcctgcccttcctgaggca
caggttccctgtatgtgccgggctcacgtggaggggccgagctgtgaccgctgcaaacct
gggttctggggactgagccccagcaaccccgagggctgtacccgctgcagctgcgacctc
aggggcacactgggtggagttgctgagtgccagccgggcaccggccagtgcttctgcaag
ccccacgtgtgcggccaggcctgcgcgtcctgcaaggatggcttctttggactggatcag
gctgactattttggctgccgcagctgccggtgtgacattggcggtgcactgggccagagc
tgtgaaccgaggacgggcgtctgccggtgccgccccaacacccagggccccacctgcagc
gagcctgcgagggaccactacctcccggacctgcaccacctgcgcctggagctggaggag
gctgccacacctgagggtcacgccgtgcgctttggcttcaaccccctcgagttcgagaac
ttcagctggaggggctacgcgcagatggcacctgtccagcccaggatcgtggccaggctg
aacctgacctcccctgaccttttctggctcgtcttccgatacgtcaaccggggggccatg
agtgtgagcgggcgggtctctgtgcgagaggagggcaggtcggccacctgcgccaactgc
acagcacagagtcagcccgtggccttcccacccagcacggagcctgccttcatcaccgtg
ccccagaggggcttcggagagccctttgtgctgaaccctggcacctgggccctgcgtgtg
gaggccgaaggggtgctcctggactacgtggttctgctgcctagcgcatactacgaggcg
gcgctcctgcagctgcgggtgactgaggcctgcacataccgtccctctgcccagcagtct
ggcgacaactgcctcctctacacacacctccccctggatggcttcccctcggccgccggg
ctggaggccctgtgtcgccaggacaacagcctgccccggccctgccccacggagcagctc
agcccgtcgcacccgccactgatcacctgcacgggcagtgatgtggacgtccagcttcaa
gtggcagtgccacagccaggccgctatgccctagtggtggagtacgccaatgaggatgcc
cgccaggaggtgggcgtggccgtgcacaccccacagcgggccccccagcaggggctgctc
tccctgcacccctgcctgtacagcaccctgtgccggggcactgcccgggatacccaggac
cacctggctgtcttccacctggactcggaggccagcgtgaggctcacagccgaacaggca
cgcttcttcctgcacggggtcactctggtgcccattgaggagttcagcccggagttcgtg
gagccccgggtcagctgcatcagcagccacggcgcctttggccccaacagtgccgcctgt
ctgccctcgcgcttcccaaagccgccccagcccatcatcctcagggactgccaggtgatc
ccgctgccgcccggcctcccgctgacccacgcgcaggatctcactccagccatgtcccca
gctggaccccgacctcggccccccaccgctgtggaccctgatgcagagcccaccctgctg
cgtgagccccaggccaccgtggtcttcaccacccatgtgcccacgctgggccgctatgcc
ttcctgctgcacggctaccagccagcccaccccaccttccccgtggaagtcctcatcaac
gccggccgcgtgtggcagggccacgccaacgccagcttctgtccacatggctacggctgc
cgcaccctggtggtgtgtgagggccaggccctgctggacgtgacccacagcgagctcact
gtgaccgtgcgtgtgcccaagggccggtggctctggctggattatgtactcgtggtccct
gagaacgtctacagctttggctacctccgggaggagcccctggataaatcctatgacttc
atcagccactgcgcagcccagggctaccacatcagccccagcagctcatccctgttctgc
cgaaacgctgctgcttccctctccctcttctataacaacggagcccgtccatgtggctgc
cacgaagtaggtgctacaggccccacgtgtgagcccttcgggggccagtgtccctgccat
gcccatgtcattggccgtgactgctcccgctgtgccaccggatactggggcttccccaac
tgcaggccctgtgactgcggtgcccgcctctgtgacgagctcacgggccagtgcatctgc
ccgccacgcaccatcccgcccgactgcctgctgtgccagccccagacctttggctgccac
cccctggtcggctgtgaggagtgtaactgctcagggcccggcatccaggagctcacagac
cctacctgtgacacagacagcggccagtgcaagtgcagacccaacgtgactgggcgccgc
tgtgatacctgctctccgggcttccatggctacccccgctgccgcccctgtgactgtcac
gaggcgggcactgcgcctggcgtgtgtgaccccctcacagggcagtgctactgtaaggag
aacgtgcagggccccaaatgtgaccagtgcagccttgggaccttctcactggatgctgcc
aaccccaaaggttgcacccgctgcttctgctttggggccacggagcgctgccggagctcg
tcctacacccgccaggagttcgtggatatggagggatgggtgctgctgagcactgaccgg
caggtggtgccccacgagcggcagccagggacggagatgctccgtgcagacctgcggcac
gtgcctgaggctgtgcccgaggctttccccgagctgtactggcaggccccaccctcctac
ctgggggaccgggtgtcatcctacggtgggaccctccgttatgaactgcactcagagacc
cagcggggagatgtctttgtccccatggagagcaggccggatgtggtgctgcagggcaac
cagatgagcatcacattcctggagccggcataccccacgcctggccacgttcaccgtggg
cagctgcagctggtggaggggaacttccggcatacggagacgcgcaacactgtgtcccgc
gaggagctcatgatggtgctggccagcctggagcagctgcagatccgtgccctcttctca
cagatctcctcggctgtcttcctgcgcagggtggcactggaggtggccagcccagcaggc
cagggggccctggccagcaatgtggagctgtgcctgtgccccgccagctaccggggggac
tcatgccaggaatgtgcccccggcttctatcgggacgtcaaaggtctcttcctgggccga
tgtgtcccttgtcagtgccatggacactcagaccgctgcctccctggctctggcgtctgt
gtggactgccagcacaacaccgaaggggcccactgtgagcgctgccaggctggcttcgtg
agcagcagggacgaccccagcgccccctgtgtcagctgcccctgccccctctcagtgcct
tccaacaacttcgccgagggctgtgtcctgcgaggcggccgcacccagtgcctctgcaaa
cctggttatgcaggtgcctcctgcgagcggtgtgcgcccggattctttgggaacccactg
gtgctgggcagctcctgccagccatgcgactgcagcggcaacggtgaccccaacttgctc
ttcagcgactgcgaccccctgacgggcgcctgccgtggctgcctgcgccacaccactggg
ccccgctgcgagatctgtgcccccggcttctacggcaacgccctgctgcccggcaactgc
acccggtgcgactgtaccccatgtgggacagaggcctgcgacccccacagcgggcactgc
ctgtgcaaggcgggcgtgactgggcggcgctgtgaccgctgccaggagggacattttggt
ttcgatggctgcgggggctgccgcccgtgtgcttgtggaccggccgccgagggctccgag
tgccacccccagagcggacagtgccactgccgaccagggaccatgggaccccagtgccgc
gagtgtgcccctggctactgggggctccctgagcagggctgcaggcgctgccagtgccct
gggggccgctgtgaccctcacacgggccgctgcaactgccccccggggctcagcggggag
cgctgcgacacctgcagccagcagcatcaggtgcctgttccaggcgggcctgtgggccac
agcatccactgtgaagtgtgtgaccactgtgtggtcctgctcctggatgacctggaacgg
gccggcgccctcctccccgccattcacgagcaactgcgtggcatcaatgccagctccatg
gcctgggcccgtctgcacaggctgaacgcctccatcgctgacctgcagagccagctccgg
agccccctgggcccccgccatgagacggcacagcagctggaggtgctggagcagcagagc
acaagcctcgggcaggacgcacggcggctaggcggccaggccgtggggacccgagaccag
gcgagccaattgctggccggcaccgaggccacactgggccatgcgaagacgctgttggcg
gccatccgggctgtggaccgcaccctgagcgagctcatgtcccagacgggccacctgggg
ctggccaatgcctcggctccatcaggtgagcagctgctccggacactggccgaggtggag
cggctgctctgggagatgcgggcccgggacctgggggccccgcaggcagcagctgaggct
gagttggctgcagcacagagattgctggcccgggtgcaggagcagctgagcagcctctgg
gaggagaaccaggcactggccacacaaacccgcgaccggctggcccagcacgaggccggc
ctcatggacctgcgagaggctttgaaccgggcagtggacgccacacgggaggcccaggag
ctcaacagccgcaaccaggagcgcctggaggaagccctgcaaaggaagcaggagctgtcc
cgggacaatgccaccctgcaggccactctgcatgcggctagggacaccctggccagcgtc
ttcagattgctgcacagcctggaccaggctaaggaggagctggagcgcctcgccgccagc
ctggacggggctcggaccccactgctgcagaggatgcagaccttctccccggcgggcagc
aagctgcgtctagtggaggccgccgaggcccacgcacagcagctgggccagctggcactc
aatctgtccagcatcatcctggacgtcaaccaggaccgcctcacccagagggccatcgag
gcctccaacgcctacagccgcatcctgcaggccgtgcaggctgccgaggatgctgctggc
caggccctgcagcaggcggaccacacgtgggcgacggtggtgcggcagggcctggtggac
cgagcccagcagctcctggccaacagcactgcactagaagaggccatgctccaggaacag
cagaggctgggccttgtgtgggctgccctccagggtgccaggacccagctccgagatgtc
cgggccaagaaggaccagctggaggcgcacatccaggcggcgcaggccatgcttgccatg
gacacagacgagacaagcaagaagatcgcacatgccaaggctgtggctgctgaagcccag
gacaccgccacccgtgtgcagtcccagctgcaggccatgcaggagaatgtggagcggtgg
cagggccagtacgagggcctgcggggccaggacctgggccaggcagtgcttgacgcaggc
cactcagtgtccaccctggagaagacgctgccccagctgctggccaagctgagcatcctg
gagaaccgtggggtgcacaacgccagcctggccctgtccgccagcattggccgcgtgcga
gagctcattgcccaggcccggggggctgccagtaaggtcaaggtgcccatgaagttcaac
gggcgctcaggggtgcagctgcgcaccccacgggatcttgccgaccttgctgcctacact
gccctcaagttctacctgcagggcccagagcctgagcctgggcagggtaccgaggatcgc
tttgtgatgtacatgggcagccgccaggccactggggactacatgggtgtgtctctgcgt
gacaagaaggtgcactgggtgtatcagctgggtgaggcgggccctgcagtcctaagcatc
gatgaggacattggggagcagttcgcagctgtcagcctggacaggactctccagtttggc
cacatgtccgtcacagtggagagacagatgatccaggaaaccaagggtgacacggtggcc
cctggggcagaggggctgctcaacctgcggccagacgacttcgtcttctacgtcgggggg
taccccagtaccttcacgccccctcccctgcttcgcttccccggctaccggggctgcatc
gagatggacacgctgaatgaggaggtggtcagcctctacaacttcgagaggaccttccag
ctggacacggctgtggacaggccttgtgcccgctccaagtcgaccggggacccgtggctc
acggacggctcctacctggacggcaccggcttcgcccgcatcagcttcgacagtcagatc
agcaccaccaagcgcttcgagcaggagctgcggctcgtgtcctacagcggggtgctcttc
ttcctgaagcagcagagccagttcctgtgcttggccgtgcaagaaggcagcctcgtgctg
ttgtatgactttggggctggcctgaaaaaggccgtcccactgcagcccccaccgcccctg
acctcggccagcaaggcgatccaggtgttcctgctggggggcagccgcaagcgtgtgctg
gtgcgtgtggagcgggccacggtgtacagcgtggagcaggacaatgatctggagctggcc
gacgcctactacctggggggcgtgccgcccgaccagctgcccccgagcctgcgacggctc
ttccccaccggaggctcagtccgtggctgcgtcaaaggcatcaaggccctgggcaagtat
gtggacctcaagcggctgaacacgacaggcgtgagcgccggctgcaccgccgacctgctg
gtggggcgcgccatgactttccatggccacggcttccttcgcctggcgctctcgaacgtg
gcaccgctcactggcaacgtctactccggcttcggcttccacagcgcccaggacagtgcc
ctgctctactaccgggcgtccccggatgggctatgccaggtgtccctgcagcagggccgt
gtgagcctacagctcctgaggactgaagtgaaaactcaagcgggcttcgccgatggtgcc
ccccattacgtcgccttctacagcaatgccacgggagtctggctgtatgtcgatgaccag
ctccagcagatgaagccccaccggggaccaccccccgagctccagccgcagcctgagggg
cccccgaggctcctcctgggaggcctgcctgagtctggcaccatttacaacttcagtggc
tgcatcagcaacgtcttcgtgcagcggctcctgggcccacagcgcgtatttgatctgcag
cagaacctgggcagcgtcaatgtgagcacgggctgtgcacccgccctgcaagcccagacc
ccgggcctggggcctagaggactgcaggccaccgcccggaaggcctcccgccgcagccgt
cagcccgcccggcatcctgcctgcatgctgcccccacacctcaggaccacccgagactcc
taccagtttgggggttccctgtccagtcacctggagtttgtgggcatcctggcccgacat
aggaactggcccagtctctccatgcacgtcctcccgcgaagctcccgaggcctcctcctc
ttcactgcccgtctgaggcccggcagcccctccctggcgctcttcctgagcaatggccac
ttcgttgcacagatggaaggcctcgggactcggctccgcgcccagagccgccagcgctcc
cggcctggccgctggcacaaggtctccgtgcgctgggagaagaaccggatcctgctggtg
acggacggggcccgggcctggagccaggaggggccgcaccggcagcaccagggggcagag
cacccccagccccacaccctctttgtgggcggcctcccggccagcagccacagctccaaa
cttccggtgaccgtcgggttcagcggctgtgtgaagagactgaggctgcacgggaggccc
ctgggggcccccacacggatggcaggggtcacaccctgcatcttgggccccctggaggcg
ggcctgttcttcccaggcagcgggggagttatcactttagacctcccaggagctacactg
cctgatgtgggcctggaactggaggtgcggcccctggcagtcaccggactgatcttccac
ttgggccaggcccggacgcccccctacttgcagttgcaggtgaccgagaagcaagtcctg
ctgcgggcggatgacggagcaggggagttctccacgtcagtgacccgcccctcagtgctg
tgtgatggccagtggcaccggctagcggtgatgaaaagcgggaatgtgctccggctggag
gtggacgcgcagagcaaccacaccgtgggccccttgctggcggctgcagctggtgcccca
gcccctctgtacctcgggggcctgcctgagcccatggccgtgcagccctggccccccgcc
tactgcggctgcatgaggaggctggcggtgaaccggtcccccgtcgccatgactcgctct
gtggaggtccacggggcagtgggggccagtggctgcccagccgcctag

DBGET integrated database retrieval system