KEGG   Homo sapiens (human): 3913Help
Entry
3913              CDS       T01001                                 

Gene name
LAMB2, LAMS, NPHS5
Definition
laminin, beta 2 (laminin S)
Orthology
K06243  
laminin, beta 2
Organism
hsa  Homo sapiens (human)
Pathway
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Toxoplasmosis
Amoebiasis
Pathways in cancer
Small cell lung cancer
Disease
H00576  
Pierson syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    3913 (LAMB2)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    3913 (LAMB2)
 Cellular Processes
  Cell communication
   04510 Focal adhesion
    3913 (LAMB2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    3913 (LAMB2)
   05222 Small cell lung cancer
    3913 (LAMB2)
  Infectious diseases
   05146 Amoebiasis
    3913 (LAMB2)
   05145 Toxoplasmosis
    3913 (LAMB2)
Cell adhesion molecules and their ligands [BR:hsa04516]
 2. Integrin Family
  Beta1 integrins
   VLA-3
    ITGB1; integrin beta 1 [KO:K05719]
     Laminin-11 Extracellular matrix (ECM) components
      3913 (LAMB2)
   VLA-6
      3913 (LAMB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
3p21
AA seq 1798 aa AA seqDB search
MELTSRERGRGQPLPWELRLGLLLSVLAATLAQAPAPDVPGCSRGSCYPATGDLLVGRAD
RLTASSTCGLNGPQPYCIVSHLQDEKKCFLCDSRRPFSARDNPHSHRIQNVVTSFAPQRR
AAWWQSENGIPAVTIQLDLEAEFHFTHLIMTFKTFRPAAMLVERSADFGRTWHVYRYFSY
DCGADFPGVPLAPPRHWDDVVCESRYSEIEPSTEGEVIYRVLDPAIPIPDPYSSRIQNLL
KITNLRVNLTRLHTLGDNLLDPRREIREKYYYALYELVVRGNCFCYGHASECAPAPGAPA
HAEGMVHGACICKHNTRGLNCEQCQDFYRDLPWRPAEDGHSHACRKCECHGHTHSCHFDM
AVYLASGNVSGGVCDGCQHNTAGRHCELCRPFFYRDPTKDLRDPAVCRSCDCDPMGSQDG
GRCDSHDDPALGLVSGQCRCKEHVVGTRCQQCRDGFFGLSISDRLGCRRCQCNARGTVPG
STPCDPNSGSCYCKRLVTGRGCDRCLPGHWGLSHDLLGCRPCDCDVGGALDPQCDEGTGQ
CHCRQHMVGRRCEQVQPGYFRPFLDHLIWEAEDTRGQVLDVVERLVTPGETPSWTGSGFV
RLQEGQTLEFLVASVPKAMDYDLLLRLEPQVPEQWAELELIVQRPGPVPAHSLCGHLVPK
DDRIQGTLQPHARYLIFPNPVCLEPGISYKLHLKLVRTGGSAQPETPYSGPGLLIDSLVL
LPRVLVLEMFSGGDAAALERQATFERYQCHEEGLVPSKTSPSEACAPLLISLSTLIYNGA
LPCQCNPQGSLSSECNPHGGQCLCKPGVVGRRCDLCAPGYYGFGPTGCQACQCSHEGALS
SLCEKTSGQCLCRTGAFGLRCDRCQRGQWGFPSCRPCVCNGHADECNTHTGACLGCRDHT
GGEHCERCIAGFHGDPRLPYGGQCRPCPCPEGPGSQRHFATSCHQDEYSQQIVCHCRAGY
TGLRCEACAPGHFGDPSRPGGRCQLCECSGNIDPMDPDACDPHTGQCLRCLHHTEGPHCA
HCKPGFHGQAARQSCHRCTCNLLGTNPQQCPSPDQCHCDPSSGQCPCLPNVQGPSCDRCA
PNFWNLTSGHGCQPCACHPSRARGPTCNEFTGQCHCRAGFGGRTCSECQELHWGDPGLQC
HACDCDSRGIDTPQCHRFTGHCSCRPGVSGVRCDQCARGFSGIFPACHPCHACFGDWDRV
VQDLAARTQRLEQRAQELQQTGVLGAFESSFWHMQEKLGIVQGIVGARNTSAASTAQLVE
ATEELRREIGEATEHLTQLEADLTDVQDENFNANHALSGLERDRLALNLTLRQLDQHLDL
LKHSNFLGAYDSIRHAHSQSAEAERRANTSALAVPSPVSNSASARHRTEALMDAQKEDFN
SKHMANQRALGKLSAHTHTLSLTDINELVCGAPGDAPCATSPCGGAGCRDEDGQPRCGGL
SCNGAAATADLALGRARHTQAELQRALAEGGSILSRVAETRRQASEAQQRAQAALDKANA
SRGQVEQANQELQELIQSVKDFLNQEGADPDSIEMVATRVLELSIPASAEQIQHLAGAIA
ERVRSLADVDAILARTVGDVRRAEQLLQDARRARSWAEDEKQKAETVQAALEEAQRAQGI
AQGAIRGAVADTRDTEQTLYQVQERMAGAERALSSAGERARQLDALLEALKLKRAGNSLA
ASTAEETAGSAQGRAQEAEQLLRGPLGDQYQTVKALAERKAQGVLAAQARAEQLRDEARD
LLQAAQDKLQRLQELEGTYEENERALESKAAQLDGLEARMRSVLQAINLQVQIYNTCQ
NT seq 5397 nt NT seq  +upstreamnt  +downstreamnt
atggagctgacctcaagggaaagagggaggggacagcctctgccctgggaacttcgactg
ggcctactgctaagcgtgctggctgccacactggcacaggcccctgccccggatgtgcct
ggctgttccaggggaagctgctaccccgccacgggcgacctgctggtgggccgagctgac
agactgactgcctcatccacttgtggcctgaatggcccccagccctactgcatcgtcagt
cacctgcaggacgaaaagaagtgcttcctttgtgactcccggcgccccttctctgctaga
gacaacccacacagccatcgcatccagaatgtagtcaccagctttgcaccacagcggcgg
gcagcctggtggcagtcagagaatggtatccctgcggtcaccatccagctggacctggag
gctgagtttcatttcacacacctcattatgaccttcaagacatttcgccctgctgccatg
ctggtggaacgctcagcagactttggccgcacctggcatgtgtaccgatatttctcctat
gactgtggggctgacttcccaggagtcccactagcacccccacggcactgggatgatgta
gtctgtgagtcccgctactcagagattgagccatccactgaaggcgaggtcatctatcgt
gtgctggaccctgccatccctatcccagacccctacagctcacggattcagaacctgttg
aagatcaccaacctacgggtgaacctgactcgtctacacacgttgggagacaacctactc
gacccacggagggagatccgagagaagtactactatgccctctatgagctggttgtacgt
ggcaactgcttctgctacggacacgcctcagagtgtgcacccgccccaggggcaccagcc
catgctgagggcatggtgcacggagcttgcatctgcaaacacaacacacgtggcctcaac
tgcgagcagtgtcaggatttctatcgtgacctgccctggcgtccggctgaggacggccat
agtcatgcctgtaggaagtgtgagtgccatgggcacacccacagctgccacttcgacatg
gccgtatacctggcatctggcaatgtgagtggaggtgtgtgtgatggatgtcagcataac
acagctgggcgccactgtgagctctgtcggcccttcttctaccgtgacccaaccaaggac
ctgcgggatccggctgtgtgccgctcctgtgattgtgaccccatgggttctcaagacggt
ggtcgctgtgattcccatgatgaccctgcactgggactggtctccggccagtgtcgctgc
aaagaacatgtggtgggcactcgctgccagcaatgccgtgatggcttctttgggctcagc
atcagtgaccgtctgggctgccggcgatgtcaatgtaatgcacggggcacagtgcctggg
agcactccttgtgaccccaacagtggatcctgttactgcaaacgtctagtgactggacgt
ggatgtgaccgctgcctgcctggccactggggcctgagccacgacctgctcggctgccgc
ccctgtgactgcgacgtgggtggtgctttggatccccagtgtgatgagggcacaggtcaa
tgccactgccgccagcacatggttgggcgacgctgtgagcaggtgcaacctggctacttc
cggcccttcctggaccacctaatttgggaggctgaggacacccgagggcaggtgctcgat
gtggtggagcgcctggtgacccccggggaaactccatcctggactggctcaggcttcgtg
cggctacaggaaggtcagaccctggagttcctggtggcctctgtgccgaaggctatggac
tatgacctgctgctgcgcttagagccccaggtccctgagcaatgggcagagttggaactg
attgtgcagcgtccagggcctgtgcctgcccacagcctgtgtgggcatttggtgcccaag
gatgatcgcatccaagggactctgcaaccacatgccaggtacttgatatttcctaatcct
gtctgccttgagcctggtatctcctacaagctgcatctgaagctggtacggacaggggga
agtgcccagcctgagactccctactctggacctggcctgctcattgactcgctggtgctg
ctgccccgtgtcctggtgctagagatgtttagtgggggtgatgctgctgccctggagcgc
caggccacctttgaacgctaccaatgccatgaggagggtctggtgcccagcaagacttct
ccctctgaggcctgcgcacccctcctcatcagcctgtccaccctcatctacaatggtgcc
ctgccatgtcagtgcaaccctcaaggttcactgagttctgagtgcaaccctcatggtggt
cagtgcctgtgcaagcctggagtggttgggcgccgctgtgacctctgtgcccctggctac
tatggctttggccccacaggctgtcaagcctgccagtgcagccacgagggggcactcagc
agtctctgtgaaaagaccagtgggcaatgtctctgtcgaactggtgcctttgggcttcgc
tgtgaccgctgccagcgtggccagtggggattccctagctgccggccatgtgtctgcaat
gggcatgcagatgagtgcaacacccacacaggcgcttgcctgggctgccgtgatcacaca
gggggtgagcactgtgaaaggtgcattgctggtttccacggggacccacggctgccatat
gggggccagtgccggccctgtccctgtcctgaaggccctgggagccaacggcactttgct
acttcttgccaccaggatgaatattcccagcagattgtgtgccactgccgggcaggctat
acggggctgcgatgtgaagcttgtgcccctgggcactttggggacccatcaaggccaggt
ggccggtgccaactgtgtgagtgcagtgggaacattgacccaatggatcctgatgcctgt
gacccccacacggggcaatgcctgcgctgtttacaccacacagagggtccacactgtgcc
cactgcaagcctggcttccatgggcaggctgcccgacagagctgtcaccgctgcacatgc
aacctgctgggcacaaatccgcagcagtgcccatctcctgaccagtgccactgtgatcca
agcagtgggcagtgcccatgcctccccaatgtccagggccctagctgtgaccgctgtgcc
cccaacttctggaacctcaccagtggccatggttgccagccttgtgcctgccacccaagc
cgggccagaggccccacctgcaacgagttcacagggcagtgccactgccgtgccggcttt
ggagggcggacttgttctgagtgccaagagctccactggggagaccctgggttgcagtgc
catgcctgtgattgtgactctcgtggaatagatacacctcagtgtcaccgcttcacaggt
cactgcagctgccgcccaggggtgtctggtgtgcgctgtgaccagtgtgcccgtggcttc
tcaggaatctttcctgcctgccatccctgccatgcatgcttcggggattgggaccgagtg
gtgcaggacttggcagcccgtacacagcgcctagagcagcgggcgcaggagttgcaacag
acgggtgtgctgggtgcctttgagagcagcttctggcacatgcaggagaagctgggcatt
gtgcagggcatcgtaggtgcccgcaacacctcagccgcctccactgcacagcttgtggag
gccacagaggagctgcggcgtgaaattggggaggccactgagcacctgactcagctcgag
gcagacctgacagatgtgcaagatgagaacttcaatgccaaccatgcactaagtggtctg
gagcgagataggcttgcacttaatctcacactgcggcagctcgaccagcatcttgacttg
ctcaaacattcaaacttcctgggtgcctatgacagcatccggcatgcccatagccagtct
gcagaggcagaacgtcgtgccaatacctcagccctggcagtacctagccctgtgagcaac
tcggcaagtgctcggcatcggacagaggcactgatggatgctcagaaggaggacttcaac
agcaaacacatggccaaccagcgggcacttggcaagctctctgcccatacccacaccctg
agcctgacagacataaatgagctggtgtgtggggcaccaggggatgcaccctgtgctaca
agcccttgtgggggtgccggctgtcgagatgaggatgggcagccgcgctgtgggggcctc
agctgcaatggggcagcggctacagcagacctagcactgggccgggcccggcacacacag
gcagagctgcagcgggcactggcagaaggtggtagcatcctcagcagagtggctgagact
cgtcggcaggcaagcgaggcacagcagcgggcccaggcagccctggacaaggctaatgct
tccaggggacaggtggaacaggccaaccaggaacttcaagaacttatccagagtgtgaag
gacttcctcaaccaggagggggctgatcctgatagcattgaaatggtggccacacgggtg
ctagagctctccatcccagcttcagctgagcagatccagcacctggcgggtgcgattgca
gagcgagtccggagcctggcagatgtggatgcgatcctggcacgtactgtaggagatgtg
cgtcgtgccgagcagctactgcaggatgcacggcgggcaaggagctgggctgaggatgag
aaacagaaggcagagacagtacaggcagcactggaggaggcccagcgggcacagggtatt
gcccagggtgccatccggggggcagtggctgacacacgggacacagagcagaccctgtac
caggtacaggagaggatggcaggtgcagagcgggcactgagctctgcaggtgaaagggct
cggcagttggatgctctcctggaggctctgaaattgaaacgggcaggaaatagtctggca
gcctctacagcagaagaaacggcaggcagtgcccagggtcgtgcccaggaggctgagcag
ctgctacgcggtcctctgggtgatcagtaccagacggtgaaggccctagctgagcgcaag
gcccaaggtgtgctggctgcacaggcaagggcagaacaactgcgggatgaggctcgggac
ctgttgcaagccgctcaggacaagctgcagcggctacaggaattggaaggcacctatgag
gaaaatgagcgggcactggagagtaaggcagcccagttggacgggttggaggccaggatg
cgcagcgtgcttcaagccatcaacttgcaggtgcagatctacaacacctgccagtga

  All links  
No link information was found.   
DBGET integrated database retrieval system