KEGG   Homo sapiens (human): 3932Help
Entry
3932              CDS       T01001                                 

Gene name
LCK, IMD22, LSK, YT16, p56lck, pp58lck
Definition
(RefSeq) LCK proto-oncogene, Src family tyrosine kinase (EC:2.7.10.2)
  KO
K05856  
lymphocyte cell-specific protein tyrosine kinase [EC:2.7.10.2]
Organism
hsa  Homo sapiens (human)
Pathway
NF-kappa B signaling pathway
Osteoclast differentiation
Natural killer cell mediated cytotoxicity
T cell receptor signaling pathway
HTLV-I infection
Primary immunodeficiency
Disease
H00093  
Combined immunodeficiencies (CIDs)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04064 NF-kappa B signaling pathway
    3932 (LCK)
 Organismal Systems
  Immune system
   04650 Natural killer cell mediated cytotoxicity
    3932 (LCK)
   04660 T cell receptor signaling pathway
    3932 (LCK)
  Development
   04380 Osteoclast differentiation
    3932 (LCK)
 Human Diseases
  Immune diseases
   05340 Primary immunodeficiency
    3932 (LCK)
  Infectious diseases
   05166 HTLV-I infection
    3932 (LCK)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     3932 (LCK)
Protein kinases [BR:hsa01001]
 Tyrosine protein kinases
  Src family
   3932 (LCK)
Chromosome [BR:hsa03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    3932 (LCK)
Cell adhesion molecules and their ligands [BR:hsa04516]
 1. Immunoglobulin Superfamily
  Immune system
   CD2 family
    CD48, BCM1; CD48 antigen [KO:K06479]
     3932 (LCK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1p34.3
AA seq 509 aa AA seqDB search
MGCGCSSHPEDDWMENIDVCENCHYPIVPLDGKGTLLIRNGSEVRDPLVTYEGSNPPASP
LQDNLVIALHSYEPSHDGDLGFEKGEQLRILEQSGEWWKAQSLTTGQEGFIPFNFVAKAN
SLEPEPWFFKNLSRKDAERQLLAPGNTHGSFLIRESESTAGSFSLSVRDFDQNQGEVVKH
YKIRNLDNGGFYISPRITFPGLHELVRHYTNASDGLCTRLSRPCQTQKPQKPWWEDEWEV
PRETLKLVERLGAGQFGEVWMGYYNGHTKVAVKSLKQGSMSPDAFLAEANLMKQLQHQRL
VRLYAVVTQEPIYIITEYMENGSLVDFLKTPSGIKLTINKLLDMAAQIAEGMAFIEERNY
IHRDLRAANILVSDTLSCKIADFGLARLIEDNEYTAREGAKFPIKWTAPEAINYGTFTIK
SDVWSFGILLTEIVTHGRIPYPGMTNPEVIQNLERGYRMVRPDNCPEELYQLMRLCWKER
PEDRPTFDYLRSVLEDFFTATEGQYQPQP
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgggctgtggctgcagctcacacccggaagatgactggatggaaaacatcgatgtgtgt
gagaactgccattatcccatagtcccactggatggcaagggcacgctgctcatccgaaat
ggctctgaggtgcgggacccactggttacctacgaaggctccaatccgccggcttcccca
ctgcaagacaacctggttatcgctctgcacagctatgagccctctcacgacggagatctg
ggctttgagaagggggaacagctccgcatcctggagcagagcggcgagtggtggaaggcg
cagtccctgaccacgggccaggaaggcttcatccccttcaattttgtggccaaagcgaac
agcctggagcccgaaccctggttcttcaagaacctgagccgcaaggacgcggagcggcag
ctcctggcgcccgggaacactcacggctccttcctcatccgggagagcgagagcaccgcg
ggatcgttttcactgtcggtccgggacttcgaccagaaccagggagaggtggtgaaacat
tacaagatccgtaatctggacaacggtggcttctacatctcccctcgaatcacttttccc
ggcctgcatgaactggtccgccattacaccaatgcttcagatgggctgtgcacacggttg
agccgcccctgccagacccagaagccccagaagccgtggtgggaggacgagtgggaggtt
cccagggagacgctgaagctggtggagcggctgggggctggacagttcggggaggtgtgg
atggggtactacaacgggcacacgaaggtggcggtgaagagcctgaagcagggcagcatg
tccccggacgccttcctggccgaggccaacctcatgaagcagctgcaacaccagcggctg
gttcggctctacgctgtggtcacccaggagcccatctacatcatcactgaatacatggag
aatgggagtctagtggattttctcaagaccccttcaggcatcaagttgaccatcaacaaa
ctcctggacatggcagcccaaattgcagaaggcatggcattcattgaagagcggaattat
attcatcgtgaccttcgggctgccaacattctggtgtctgacaccctgagctgcaagatt
gcagactttggcctagcacgcctcattgaggacaacgagtacacagccagggagggggcc
aagtttcccattaagtggacagcgccagaagccattaactacgggacattcaccatcaag
tcagatgtgtggtcttttgggatcctgctgacggaaattgtcacccacggccgcatccct
tacccagggatgaccaacccggaggtgattcagaacctggagcgaggctaccgcatggtg
cgccctgacaactgtccagaggagctgtaccaactcatgaggctgtgctggaaggagcgc
ccagaggaccggcccacctttgactacctgcgcagtgtgctggaggacttcttcacggcc
acagagggccagtaccagcctcagccttga

DBGET integrated database retrieval system