KEGG   Homo sapiens (human): 3939Help
Entry
3939              CDS       T01001                                 

Gene name
LDHA, GSD11, HEL-S-133P, LDHM, PIG19
Definition
(RefSeq) lactate dehydrogenase A
  KO
K00016  L-lactate dehydrogenase [EC:1.1.1.27]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00010  Glycolysis / Gluconeogenesis
hsa00270  Cysteine and methionine metabolism
hsa00620  Pyruvate metabolism
hsa00640  Propanoate metabolism
hsa01100  Metabolic pathways
hsa04066  HIF-1 signaling pathway
hsa04922  Glucagon signaling pathway
hsa05230  Central carbon metabolism in cancer
Disease
H00069  Glycogen storage diseases (GSD)
H01762  Muscle glycogen storage disease
H01946  Glycogen storage disease type XI
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    3939 (LDHA)
   00620 Pyruvate metabolism
    3939 (LDHA)
   00640 Propanoate metabolism
    3939 (LDHA)
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    3939 (LDHA)
 Environmental Information Processing
  Signal transduction
   04066 HIF-1 signaling pathway
    3939 (LDHA)
 Organismal Systems
  Endocrine system
   04922 Glucagon signaling pathway
    3939 (LDHA)
 Human Diseases
  Cancers
   05230 Central carbon metabolism in cancer
    3939 (LDHA)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.27  L-lactate dehydrogenase
     3939 (LDHA)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   3939 (LDHA)
  Exosomal proteins of breast milk
   3939 (LDHA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ldh_1_N Ldh_1_C Glyco_hydro_4 Pyr_redox_2 Glyco_hydro_4C
Motif
Other DBs
NCBI-GeneID: 3939
NCBI-ProteinID: NP_005557
OMIM: 150000
HGNC: 6535
Ensembl: ENSG00000134333
Vega: OTTHUMG00000167721
Pharos: P00338(Tchem)
UniProt: P00338 V9HWB9
Structure
PDB: 

Jmol
Position
11p15.1
AA seq 332 aa AA seqDB search
MATLKDQLIYNLLKEEQTPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKG
EMMDLQHGSLFLRTPKIVSGKDYNVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFI
IPNVVKYSPNCKLLIVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGV
HPLSCHGWVLGEHGDSSVPVWSGMNVAGVSLKTLHPDLGTDKDKEQWKEVHKQVVESAYE
VIKLKGYTSWAIGLSVADLAESIMKNLRRVHPVSTMIKGLYGIKDDVFLSVPCILGQNGI
SDLVKVTLTSEEEARLKKSADTLWGIQKELQF
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atggcaactctaaaggatcagctgatttataatcttctaaaggaagaacagaccccccag
aataagattacagttgttggggttggtgctgttggcatggcctgtgccatcagtatctta
atgaaggacttggcagatgaacttgctcttgttgatgtcatcgaagacaaattgaaggga
gagatgatggatctccaacatggcagccttttccttagaacaccaaagattgtctctggc
aaagactataatgtaactgcaaactccaagctggtcattatcacggctggggcacgtcag
caagagggagaaagccgtcttaatttggtccagcgtaacgtgaacatctttaaattcatc
attcctaatgttgtaaaatacagcccgaactgcaagttgcttattgtttcaaatccagtg
gatatcttgacctacgtggcttggaagataagtggttttcccaaaaaccgtgttattgga
agcggttgcaatctggattcagcccgattccgttacctaatgggggaaaggctgggagtt
cacccattaagctgtcatgggtgggtccttggggaacatggagattccagtgtgcctgta
tggagtggaatgaatgttgctggtgtctctctgaagactctgcacccagatttagggact
gataaagataaggaacagtggaaagaggttcacaagcaggtggttgagagtgcttatgag
gtgatcaaactcaaaggctacacatcctgggctattggactctctgtagcagatttggca
gagagtataatgaagaatcttaggcgggtgcacccagtttccaccatgattaagggtctt
tacggaataaaggatgatgtcttccttagtgttccttgcattttgggacagaatggaatc
tcagaccttgtgaaggtgactctgacttctgaggaagaggcccgtttgaagaagagtgca
gatacactttgggggatccaaaaggagctgcaattttaa

DBGET integrated database retrieval system