KEGG   Homo sapiens (human): 3976Help
Entry
3976              CDS       T01001                                 

Gene name
LIF, CDF, DIA, HILDA, MLPLI
Definition
(RefSeq) leukemia inhibitory factor
  KO
K05419  
leukemia inhibitory factor
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
Signaling pathways regulating pluripotency of stem cells
Jak-STAT signaling pathway
TNF signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    3976 (LIF)
   04668 TNF signaling pathway
    3976 (LIF)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3976 (LIF)
 Cellular Processes
  Cellular commiunity
   04550 Signaling pathways regulating pluripotency of stem cells
    3976 (LIF)
Cytokines [BR:hsa04052]
 Class I cytokines (hematopoietin family)
  IL-6 receptor family
   3976 (LIF)
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
22q12.2
AA seq 202 aa AA seqDB search
MKVLAAGVVPLLLVLHWKHGAGSPLPITPVNATCAIRHPCHNNLMNQIRSQLAQLNGSAN
ALFILYYTAQGEPFPNNLDKLCGPNVTDFPPFHANGTEKAKLVELYRIVVYLGTSLGNIT
RDQKILNPSALSLHSKLNATADILRGLLSNVLCRLCSKYHVGHVDVTYGPDTSGKDVFQK
KKLGCQLLGKYKQIIAVLAQAF
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtcttggcggcaggagttgtgcccctgctgttggttctgcactggaaacatggg
gcggggagccccctccccatcacccctgtcaacgccacctgtgccatacgccacccatgt
cacaacaacctcatgaaccagatcaggagccaactggcacagctcaatggcagtgccaat
gccctctttattctctattacacagcccagggggagccgttccccaacaacctggacaag
ctatgtggccccaacgtgacggacttcccgcccttccacgccaacggcacggagaaggcc
aagctggtggagctgtaccgcatagtcgtgtaccttggcacctccctgggcaacatcacc
cgggaccagaagatcctcaaccccagtgccctcagcctccacagcaagctcaacgccacc
gccgacatcctgcgaggcctccttagcaacgtgctgtgccgcctgtgcagcaagtaccac
gtgggccatgtggacgtgacctacggccctgacacctcgggtaaggatgtcttccagaag
aagaagctgggctgtcaactcctggggaagtataagcagatcatcgccgtgttggcccag
gccttctag

DBGET integrated database retrieval system