KEGG   Homo sapiens (human): 3976Help
Entry
3976              CDS       T01001                                 

Gene name
LIF, CDF, DIA, HILDA, MLPLI
Definition
leukemia inhibitory factor
Orthology
K05419  
leukemia inhibitory factor
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
Jak-STAT signaling pathway
TNF signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    3976 (LIF)
   04668 TNF signaling pathway
    3976 (LIF)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3976 (LIF)
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
22q12.2
AA seq 88 aa AA seqDB search
MKVLAAVHSPGGAVPQQPGQAMWPQRDGLPALPRQRHGEGQAGGAVPHSRVPWHLPGQHH
PGPEDPQPQCPQPPQQAQRHRRHPARPP
NT seq 267 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtcttggcggcagtacacagcccagggggagccgttccccaacaacctggacaa
gctatgtggccccaacgtgacggacttcccgcccttccacgccaacggcacggagaaggc
caagctggtggagctgtaccgcatagtcgtgtaccttggcacctccctgggcaacatcac
ccgggaccagaagatcctcaaccccagtgccctcagcctccacagcaagctcaacgccac
cgccgacatcctgcgaggcctccttag

DBGET integrated database retrieval system