KEGG   Homo sapiens (human): 399694Help
Entry
399694            CDS       T01001                                 

Gene name
SHC4, RaLP, SHCD
Definition
SHC (Src homology 2 domain containing) family, member 4
Orthology
K17449  
SHC- transforming protein 4
Organism
hsa  Homo sapiens (human)
Pathway
ErbB signaling pathway
Ras signaling pathway
Chemokine signaling pathway
Focal adhesion
Natural killer cell mediated cytotoxicity
Neurotrophin signaling pathway
Insulin signaling pathway
Estrogen signaling pathway
Prolactin signaling pathway
Alcoholism
Bacterial invasion of epithelial cells
MicroRNAs in cancer
Glioma
Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    399694 (SHC4)
   04012 ErbB signaling pathway
    399694 (SHC4)
 Cellular Processes
  Cellular commiunity
   04510 Focal adhesion
    399694 (SHC4)
 Organismal Systems
  Immune system
   04650 Natural killer cell mediated cytotoxicity
    399694 (SHC4)
   04062 Chemokine signaling pathway
    399694 (SHC4)
  Endocrine system
   04910 Insulin signaling pathway
    399694 (SHC4)
   04915 Estrogen signaling pathway
    399694 (SHC4)
   04917 Prolactin signaling pathway
    399694 (SHC4)
  Nervous system
   04722 Neurotrophin signaling pathway
    399694 (SHC4)
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    399694 (SHC4)
   05214 Glioma
    399694 (SHC4)
   05220 Chronic myeloid leukemia
    399694 (SHC4)
  Substance dependence
   05034 Alcoholism
    399694 (SHC4)
  Infectious diseases
   05100 Bacterial invasion of epithelial cells
    399694 (SHC4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
15q21.1-q21.2
AA seq 630 aa AA seqDB search
MRERGQDSLAGLVLYVGLFGHPGMLHRAKYSRFRNESITSLDEGSSGGSVGNKGSPQPPH
PALAPHLPTEDATLPSQESPTPLCTLIPRMASMKLANPATLLSLKNFCLGTKEVPRLKLQ
ESRDPGSSGPSSPETSLSRSGTAPPPQQDLVGHRATALTPDSCPLPGPGEPTLRSRQDRH
FLQHLLGMGMNYCVRYMGCVEVLQSMRSLDFGMRTQVTREAISRLCEAVPGANGAIKKRK
PPVKFLSTVLGKSNLQFSGMNIKLTISTCSLTLMNLDNQQIIANHHMQSISFASGGDPDT
TDYVAYVAKDPVNQRACHILECHNGMAQDVISTIGQAFELRFKQYLKNPSLNTSCESEEV
HIDSHAEEREDHEYYNEIPGKQPPVGGVSDMRIKVQATEQMAYCPIQCEKLCYLPGNSKC
SSVYENCLEQSRAIGNVHPRGVQSQRDTSLLKHTCRVDLFDDPCYINTQALQSTPGSAGN
QRSAQPLGSPWHCGKAPETVQPGATAQPASSHSLPHIKQQLWSEECYHGKLSRKAAESLL
VKDGDFLVRESATSPGQYVLSGLQGGQAKHLLLVDPEGKVRTKDHVFDNVGHLIRYHMDN
SLPIISSGSEVSLKQPVRKDNNPALLHSNK
NT seq 1893 nt NT seq  +upstreamnt  +downstreamnt
atgcgagaacgcggccaggacagcctggcaggactcgtgctgtatgtaggactcttcggg
caccccgggatgctgcacagggccaagtacagccgctttcggaacgagtcgatcacgtcc
ttggacgaaggtagctccggaggctcggtcgggaacaagggctcgccgcagcctccccac
cccgccctggcacctcacctgccgactgaagatgccaccttgccgtcgcaggagagcccc
accccactgtgcaccttgatcccccgcatggcaagcatgaagctggccaacccggccact
ttgctgagtctgaaaaacttttgcctgggtaccaaagaggtgcctcggctgaagctccag
gaaagccgggacccaggttccagcggcccctcttccccagaaaccagtttaagtaggtcc
gggactgcacctccaccgcagcaggacctggtgggacacagggcaaccgccctaacccct
gattcgtgcccgcttcctggccctggggagccaacacttaggagcaggcaggacaggcac
tttctacagcacctgttggggatgggcatgaactactgtgtgaggtacatgggctgtgtt
gaagtgctgcaatcaatgagatcactggattttggaatgagaacccaagttacaagggaa
gcaataagtcgcctgtgtgaagctgtccccggggcaaatggagccattaaaaagcgaaag
cctccagttaagttcctatcaacagtccttggcaaaagtaatcttcagttttcaggaatg
aatataaaactgaccatctcaacatgcagtctcacattgatgaatcttgacaaccaacag
attattgcaaatcatcatatgcagtctatttcatttgcctctggaggggatcctgatact
acagactatgttgcctacgtagctaaagatccagttaatcaacgagcctgtcacatattg
gaatgccacaatggaatggcccaagacgtcataagtaccatagggcaggcttttgaactc
cggtttaaacagtacttgaaaaatccttctttgaatacttcttgtgaaagtgaggaggtg
catattgatagccatgccgaggagagagaagatcatgaatattacaatgaaattccaggg
aagcagccaccagtaggtggtgtttcagatatgcggatcaaagttcaagccacggaacaa
atggcttactgccccatacagtgtgaaaagttgtgctatttgcctggaaactccaagtgc
agcagtgtatatgagaactgtttagaacaaagcagggcaataggtaatgtccatccaaga
ggggtgcagtcccagcgagatacctcattattgaagcacacgtgccgagtggatctcttt
gatgacccctgctacattaatacacaggctcttcaaagtacacctggctctgctggaaat
caaaggtcagcccaaccactggggagcccatggcactgcggaaaggcaccagaaactgtt
cagccgggtgccacagcccagcctgccagctcacattctttgccacacattaagcagcag
ctgtggagcgaagaatgctatcatggcaagctgagcaggaaggcggcagagagcctcttg
gtaaaggatggggactttttggttcgagagagtgcaacatcccctggccaatatgtgctg
agtggactacagggaggccaagcaaaacatcttctcctggtggatcctgaaggcaaggtg
aggaccaaggatcatgtatttgataatgtcggccaccttatcagataccatatggataac
agtttgccaatcatctcctctggaagcgaagtaagccttaaacaaccagtgagaaaagat
aataatccagcacttttgcattccaacaaatga

DBGET integrated database retrieval system