KEGG   Homo sapiens (human): 401992Help
Entry
401992            CDS       T01001                                 

Gene name
OR2T2, OR1-43, OR2T2P
Definition
(RefSeq) olfactory receptor family 2 subfamily T member 2
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    401992 (OR2T2)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    401992 (OR2T2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx
Motif
Other DBs
NCBI-GeneID: 401992
NCBI-ProteinID: NP_001004136
HGNC: 14725
Ensembl: ENSG00000196240
Vega: OTTHUMG00000040480
Pharos: Q6IF00(Tdark)
UniProt: Q6IF00
Position
1q44
AA seq 324 aa AA seqDB search
MGMEGLLQNSTNFVLTGLITHPAFPGLLFAIVFSIFVVAITANLVMILLIHMDSRLHTPM
YFLLSQLSIMDTIYICITVPKMLQDLLSKDKTISFLGCAVQIFLYLTLIGGEFFLLGLMA
YDRYVAVCNPLRYPLLMNRRVCLFMVVGSWVGGSLDGFMLTPVTMSFPFCRSREINHFFC
EIPAVLKLSCTDTSLYETLMYACCVLMLLIPLSVISVSYTHILLTVHRMNSAEGRRKAFA
TCSSHIMVVSVFYGAAFYTNVLPHSYHTPEKDKVVSAFYTILTPMLNPLIYSLRNKDVAA
ALRKVLGRCGSSQSIRVATVIRKG
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgggcatggagggtcttctccagaactccactaacttcgtcctcacaggcctcatcacc
catcctgccttccccgggcttctctttgcaatagtcttctccatctttgtggtggctata
acagccaacttggtcatgattctgctcatccacatggactcccgcctccacacacccatg
tacttcttgctcagccagctctccatcatggataccatctacatctgtatcactgtcccc
aagatgctccaggacctcctgtccaaggacaagaccatttccttcctgggctgtgcagtt
cagatcttcctctacctgaccctgattggaggggaattcttcctgctgggtctcatggcc
tatgaccgctatgtggctgtgtgcaaccctctacggtaccctctcctcatgaaccgcagg
gtttgcttattcatggtggtcggctcctgggttggtggttccttggatgggttcatgctg
actcctgtcactatgagtttccccttctgtagatcccgagagatcaatcactttttctgt
gagatcccagccgtgctgaagttgtcttgcacagacacgtcactctatgagaccctgatg
tatgcctgctgcgtgctgatgctgcttatccctctatctgtcatctctgtctcctacacg
cacatcctcctgactgtccacaggatgaactctgctgagggccggcgcaaagcctttgct
acgtgttcctcccacattatggtggtgagcgttttctacggggcagccttctacaccaac
gtgctgccccactcctaccacactccagagaaagataaagtggtgtctgccttctacacc
atcctcacccccatgctcaacccactcatctacagcttgaggaataaagatgtggctgca
gctctgaggaaagtactagggagatgtggttcctcccagagcatcagggtggcgactgtg
atcaggaagggctag

DBGET integrated database retrieval system