KEGG   Homo sapiens (human): 4035Help
Entry
4035              CDS       T01001                                 

Gene name
LRP1, A2MR, APOER, APR, CD91, IGFBP3R, LRP, LRP1A, TGFBR5
Definition
(RefSeq) LDL receptor related protein 1
  KO
K04550  
low-density lipoprotein receptor-related protein 1 (alpha-2-macroglobulin receptor)
Organism
hsa  Homo sapiens (human)
Pathway
Alzheimer's disease
Malaria
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    4035 (LRP1)
  Infectious diseases
   05144 Malaria
    4035 (LRP1)
Cell adhesion molecules and their ligands [BR:hsa04516]
 1. Immunoglobulin Superfamily
  Neural system
   Enzymatic CD
    PDGFRB; platelet-derived growth factor receptor, beta polypeptide [KO:K05089]
     4035 (LRP1)
 2. Integrin Family
  Beta2 integrins
   CR3, Mac-1
    ITGB2; integrin beta 2 [KO:K06464]
     4035 (LRP1)
 4. Link Protein Family
  CD44; CD44 antigen [KO:K06256]
   4035 (LRP1)
Cellular antigens [BR:hsa04090]
 Proteins
  4035 (LRP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
12q13.3
AA seq 4544 aa AA seqDB search
MLTPPLLLLLPLLSALVAAAIDAPKTCSPKQFACRDQITCISKGWRCDGERDCPDGSDEA
PEICPQSKAQRCQPNEHNCLGTELCVPMSRLCNGVQDCMDGSDEGPHCRELQGNCSRLGC
QHHCVPTLDGPTCYCNSSFQLQADGKTCKDFDECSVYGTCSQLCTNTDGSFICGCVEGYL
LQPDNRSCKAKNEPVDRPPVLLIANSQNILATYLSGAQVSTITPTSTRQTTAMDFSYANE
TVCWVHVGDSAAQTQLKCARMPGLKGFVDEHTINISLSLHHVEQMAIDWLTGNFYFVDDI
DDRIFVCNRNGDTCVTLLDLELYNPKGIALDPAMGKVFFTDYGQIPKVERCDMDGQNRTK
LVDSKIVFPHGITLDLVSRLVYWADAYLDYIEVVDYEGKGRQTIIQGILIEHLYGLTVFE
NYLYATNSDNANAQQKTSVIRVNRFNSTEYQVVTRVDKGGALHIYHQRRQPRVRSHACEN
DQYGKPGGCSDICLLANSHKARTCRCRSGFSLGSDGKSCKKPEHELFLVYGKGRPGIIRG
MDMGAKVPDEHMIPIENLMNPRALDFHAETGFIYFADTTSYLIGRQKIDGTERETILKDG
IHNVEGVAVDWMGDNLYWTDDGPKKTISVARLEKAAQTRKTLIEGKMTHPRAIVVDPLNG
WMYWTDWEEDPKDSRRGRLERAWMDGSHRDIFVTSKTVLWPNGLSLDIPAGRLYWVDAFY
DRIETILLNGTDRKIVYEGPELNHAFGLCHHGNYLFWTEYRSGSVYRLERGVGGAPPTVT
LLRSERPPIFEIRMYDAQQQQVGTNKCRVNNGGCSSLCLATPGSRQCACAEDQVLDADGV
TCLANPSYVPPPQCQPGEFACANSRCIQERWKCDGDNDCLDNSDEAPALCHQHTCPSDRF
KCENNRCIPNRWLCDGDNDCGNSEDESNATCSARTCPPNQFSCASGRCIPISWTCDLDDD
CGDRSDESASCAYPTCFPLTQFTCNNGRCININWRCDNDNDCGDNSDEAGCSHSCSSTQF
KCNSGRCIPEHWTCDGDNDCGDYSDETHANCTNQATRPPGGCHTDEFQCRLDGLCIPLRW
RCDGDTDCMDSSDEKSCEGVTHVCDPSVKFGCKDSARCISKAWVCDGDNDCEDNSDEENC
ESLACRPPSHPCANNTSVCLPPDKLCDGNDDCGDGSDEGELCDQCSLNNGGCSHNCSVAP
GEGIVCSCPLGMELGPDNHTCQIQSYCAKHLKCSQKCDQNKFSVKCSCYEGWVLEPDGES
CRSLDPFKPFIIFSNRHEIRRIDLHKGDYSVLVPGLRNTIALDFHLSQSALYWTDVVEDK
IYRGKLLDNGALTSFEVVIQYGLATPEGLAVDWIAGNIYWVESNLDQIEVAKLDGTLRTT
LLAGDIEHPRAIALDPRDGILFWTDWDASLPRIEAASMSGAGRRTVHRETGSGGWPNGLT
VDYLEKRILWIDARSDAIYSARYDGSGHMEVLRGHEFLSHPFAVTLYGGEVYWTDWRTNT
LAKANKWTGHNVTVVQRTNTQPFDLQVYHPSRQPMAPNPCEANGGQGPCSHLCLINYNRT
VSCACPHLMKLHKDNTTCYEFKKFLLYARQMEIRGVDLDAPYYNYIISFTVPDIDNVTVL
DYDAREQRVYWSDVRTQAIKRAFINGTGVETVVSADLPNAHGLAVDWVSRNLFWTSYDTN
KKQINVARLDGSFKNAVVQGLEQPHGLVVHPLRGKLYWTDGDNISMANMDGSNRTLLFSG
QKGPVGLAIDFPESKLYWISSGNHTINRCNLDGSGLEVIDAMRSQLGKATALAIMGDKLW
WADQVSEKMGTCSKADGSGSVVLRNSTTLVMHMKVYDESIQLDHKGTNPCSVNNGDCSQL
CLPTSETTRSCMCTAGYSLRSGQQACEGVGSFLLYSVHEGIRGIPLDPNDKSDALVPVSG
TSLAVGIDFHAENDTIYWVDMGLSTISRAKRDQTWREDVVTNGIGRVEGIAVDWIAGNIY
WTDQGFDVIEVARLNGSFRYVVISQGLDKPRAITVHPEKGYLFWTEWGQYPRIERSRLDG
TERVVLVNVSISWPNGISVDYQDGKLYWCDARTDKIERIDLETGENREVVLSSNNMDMFS
VSVFEDFIYWSDRTHANGSIKRGSKDNATDSVPLRTGIGVQLKDIKVFNRDRQKGTNVCA
VANGGCQQLCLYRGRGQRACACAHGMLAEDGASCREYAGYLLYSERTILKSIHLSDERNL
NAPVQPFEDPEHMKNVIALAFDYRAGTSPGTPNRIFFSDIHFGNIQQINDDGSRRITIVE
NVGSVEGLAYHRGWDTLYWTSYTTSTITRHTVDQTRPGAFERETVITMSGDDHPRAFVLD
ECQNLMFWTNWNEQHPSIMRAALSGANVLTLIEKDIRTPNGLAIDHRAEKLYFSDATLDK
IERCEYDGSHRYVILKSEPVHPFGLAVYGEHIFWTDWVRRAVQRANKHVGSNMKLLRVDI
PQQPMGIIAVANDTNSCELSPCRINNGGCQDLCLLTHQGHVNCSCRGGRILQDDLTCRAV
NSSCRAQDEFECANGECINFSLTCDGVPHCKDKSDEKPSYCNSRRCKKTFRQCSNGRCVS
NMLWCNGADDCGDGSDEIPCNKTACGVGEFRCRDGTCIGNSSRCNQFVDCEDASDEMNCS
ATDCSSYFRLGVKGVLFQPCERTSLCYAPSWVCDGANDCGDYSDERDCPGVKRPRCPLNY
FACPSGRCIPMSWTCDKEDDCEHGEDETHCNKFCSEAQFECQNHRCISKQWLCDGSDDCG
DGSDEAAHCEGKTCGPSSFSCPGTHVCVPERWLCDGDKDCADGADESIAAGCLYNSTCDD
REFMCQNRQCIPKHFVCDHDRDCADGSDESPECEYPTCGPSEFRCANGRCLSSRQWECDG
ENDCHDQSDEAPKNPHCTSQEHKCNASSQFLCSSGRCVAEALLCNGQDDCGDSSDERGCH
INECLSRKLSGCSQDCEDLKIGFKCRCRPGFRLKDDGRTCADVDECSTTFPCSQRCINTH
GSYKCLCVEGYAPRGGDPHSCKAVTDEEPFLIFANRYYLRKLNLDGSNYTLLKQGLNNAV
ALDFDYREQMIYWTDVTTQGSMIRRMHLNGSNVQVLHRTGLSNPDGLAVDWVGGNLYWCD
KGRDTIEVSKLNGAYRTVLVSSGLREPRALVVDVQNGYLYWTDWGDHSLIGRIGMDGSSR
SVIVDTKITWPNGLTLDYVTERIYWADAREDYIEFASLDGSNRHVVLSQDIPHIFALTLF
EDYVYWTDWETKSINRAHKTTGTNKTLLISTLHRPMDLHVFHALRQPDVPNHPCKVNNGG
CSNLCLLSPGGGHKCACPTNFYLGSDGRTCVSNCTASQFVCKNDKCIPFWWKCDTEDDCG
DHSDEPPDCPEFKCRPGQFQCSTGICTNPAFICDGDNDCQDNSDEANCDIHVCLPSQFKC
TNTNRCIPGIFRCNGQDNCGDGEDERDCPEVTCAPNQFQCSITKRCIPRVWVCDRDNDCV
DGSDEPANCTQMTCGVDEFRCKDSGRCIPARWKCDGEDDCGDGSDEPKEECDERTCEPYQ
FRCKNNRCVPGRWQCDYDNDCGDNSDEESCTPRPCSESEFSCANGRCIAGRWKCDGDHDC
ADGSDEKDCTPRCDMDQFQCKSGHCIPLRWRCDADADCMDGSDEEACGTGVRTCPLDEFQ
CNNTLCKPLAWKCDGEDDCGDNSDENPEECARFVCPPNRPFRCKNDRVCLWIGRQCDGTD
NCGDGTDEEDCEPPTAHTTHCKDKKEFLCRNQRCLSSSLRCNMFDDCGDGSDEEDCSIDP
KLTSCATNASICGDEARCVRTEKAAYCACRSGFHTVPGQPGCQDINECLRFGTCSQLCNN
TKGGHLCSCARNFMKTHNTCKAEGSEYQVLYIADDNEIRSLFPGHPHSAYEQAFQGDESV
RIDAMDVHVKAGRVYWTNWHTGTISYRSLPPAAPPTTSNRHRRQIDRGVTHLNISGLKMP
RGIAIDWVAGNVYWTDSGRDVIEVAQMKGENRKTLISGMIDEPHAIVVDPLRGTMYWSDW
GNHPKIETAAMDGTLRETLVQDNIQWPTGLAVDYHNERLYWADAKLSVIGSIRLNGTDPI
VAADSKRGLSHPFSIDVFEDYIYGVTYINNRVFKIHKFGHSPLVNLTGGLSHASDVVLYH
QHKQPEVTNPCDRKKCEWLCLLSPSGPVCTCPNGKRLDNGTCVPVPSPTPPPDAPRPGTC
NLQCFNGGSCFLNARRQPKCRCQPRYTGDKCELDQCWEHCRNGGTCAASPSGMPTCRCPT
GFTGPKCTQQVCAGYCANNSTCTVNQGNQPQCRCLPGFLGDRCQYRQCSGYCENFGTCQM
AADGSRQCRCTAYFEGSRCEVNKCSRCLEGACVVNKQSGDVTCNCTDGRVAPSCLTCVGH
CSNGGSCTMNSKMMPECQCPPHMTGPRCEEHVFSQQQPGHIASILIPLLLLLLLVLVAGV
VFWYKRRVQGAKGFQHQRMTNGAMNVEIGNPTYKMYEGGEPDDVGGLLDADFALDPDKPT
NFTNPVYATLYMGGHGSRHSLASTDEKRELLGRGPEDEIGDPLA
NT seq 13635 nt NT seq  +upstreamnt  +downstreamnt
atgctgaccccgccgttgctcctgctgctgcccctgctctcagctctggtcgcggcggct
atcgacgcccctaagacttgcagccccaagcagtttgcctgcagagatcaaataacctgt
atctcaaagggctggcggtgcgacggtgagagggactgcccagacggatctgacgaggcc
cctgagatttgtccacagagtaaggcccagcgatgccagccaaacgagcataactgcctg
ggtactgagctgtgtgttcccatgtcccgcctctgcaatggggtccaggactgcatggac
ggctcagatgaggggccccactgccgagagctccaaggcaactgctctcgcctgggctgc
cagcaccattgtgtccccacactcgatgggcccacctgctactgcaacagcagctttcag
cttcaggcagatggcaagacctgcaaagattttgatgagtgctcagtgtacggcacctgc
agccagctatgcaccaacacagacggctccttcatatgtggctgtgttgaaggatacctc
ctgcagccggataaccgctcctgcaaggccaagaacgagccagtagaccggccccctgtg
ctgttgatagccaactcccagaacatcttggccacgtacctgagtggggcccaggtgtct
accatcacacctacgagcacgcggcagaccacagccatggacttcagctatgccaacgag
accgtatgctgggtgcatgttggggacagtgctgctcagacgcagctcaagtgtgcccgc
atgcctggcctaaagggcttcgtggatgagcacaccatcaacatctccctcagtctgcac
cacgtggaacagatggccatcgactggctgacaggcaacttctactttgtggatgacatc
gatgataggatctttgtctgcaacagaaatggggacacatgtgtcacattgctagacctg
gaactctacaaccccaagggcattgccctggaccctgccatggggaaggtgtttttcact
gactatgggcagatcccaaaggtggaacgctgtgacatggatgggcagaaccgcaccaag
ctcgtcgacagcaagattgtgtttcctcatggcatcacgctggacctggtcagccgcctt
gtctactgggcagatgcctatctggactatattgaagtggtggactatgagggcaagggc
cgccagaccatcatccagggcatcctgattgagcacctgtacggcctgactgtgtttgag
aattatctctatgccaccaactcggacaatgccaatgcccagcagaagacgagtgtgatc
cgtgtgaaccgctttaacagcaccgagtaccaggttgtcacccgggtggacaagggtggt
gccctccacatctaccaccagaggcgtcagccccgagtgaggagccatgcctgtgaaaac
gaccagtatgggaagccgggtggctgctctgacatctgcctgctggccaacagccacaag
gcgcggacctgccgctgccgttccggcttcagcctgggcagtgacgggaagtcatgcaag
aagccggagcatgagctgttcctcgtgtatggcaagggccggccaggcatcatccggggc
atggatatgggggccaaggtcccggatgagcacatgatccccattgaaaacctcatgaac
ccccgagccctggacttccacgctgagaccggcttcatctactttgccgacaccaccagc
tacctcattggccgccagaagattgatggcactgagcgggagaccatcctgaaggacggc
atccacaatgtggagggtgtggccgtggactggatgggagacaatctgtactggacggac
gatgggcccaaaaagacaatcagcgtggccaggctggagaaagctgctcagacccgcaag
actttaatcgagggcaaaatgacacaccccagggctattgtggtggatccactcaatggg
tggatgtactggacagactgggaggaggaccccaaggacagtcggcgtgggcggctggag
agggcgtggatggatggctcacaccgagacatctttgtcacctccaagacagtgctttgg
cccaatgggctaagcctggacatcccggctgggcgcctctactgggtggatgccttctac
gaccgcatcgagacgatactgctcaatggcacagaccggaagattgtgtatgaaggtcct
gagctgaaccacgcctttggcctgtgtcaccatggcaactacctcttctggactgagtat
cggagtggcagtgtctaccgcttggaacggggtgtaggaggcgcaccccccactgtgacc
cttctgcgcagtgagcggccccccatctttgagatccgaatgtatgatgcccagcagcag
caagttggcaccaacaaatgccgggtgaacaatggcggctgcagcagcctgtgcttggcc
acccctgggagccgccagtgcgcctgtgctgaggaccaggtgttggacgcagacggcgtc
acttgcttggcgaacccatcctacgtgcctccaccccagtgccagccaggcgagtttgcc
tgtgccaacagccgctgcatccaggagcgctggaagtgtgacggagacaacgattgcctg
gacaacagtgatgaggccccagccctctgccatcagcacacctgcccctcggaccgattc
aagtgcgagaacaaccggtgcatccccaaccgctggctctgcgacggggacaatgactgt
gggaacagtgaagatgagtccaatgccacttgttcagcccgcacctgcccccccaaccag
ttctcctgtgccagtggccgctgcatccccatctcctggacgtgtgatctggatgacgac
tgtggggaccgctctgatgagtctgcttcgtgtgcctatcccacctgcttccccctgact
cagtttacctgcaacaatggcagatgtatcaacatcaactggagatgcgacaatgacaat
gactgtggggacaacagtgacgaagccggctgcagccactcctgttctagcacccagttc
aagtgcaacagcgggcgttgcatccccgagcactggacctgcgatggggacaatgactgc
ggagactacagtgatgagacacacgccaactgcaccaaccaggccacgaggccccctggt
ggctgccacactgatgagttccagtgccggctggatggactatgcatccccctgcggtgg
cgctgcgatggggacactgactgcatggactccagcgatgagaagagctgtgagggagtg
acccacgtctgcgatcccagtgtcaagtttggctgcaaggactcagctcggtgcatcagc
aaagcgtgggtgtgtgatggcgacaatgactgtgaggataactcggacgaggagaactgc
gagtccctggcctgcaggccaccctcgcacccttgtgccaacaacacctcagtctgcctg
ccccctgacaagctgtgtgatggcaacgacgactgtggcgacggctcagatgagggcgag
ctctgcgaccagtgctctctgaataacggtggctgcagccacaactgctcagtggcacct
ggcgaaggcattgtgtgttcctgccctctgggcatggagctggggcccgacaaccacacc
tgccagatccagagctactgtgccaagcatctcaaatgcagccaaaagtgcgaccagaac
aagttcagcgtgaagtgctcctgctacgagggctgggtcctggaacctgacggcgagagc
tgccgcagcctggaccccttcaagccgttcatcattttctccaaccgccatgaaatccgg
cgcatcgatcttcacaaaggagactacagcgtcctggtgcccggcctgcgcaacaccatc
gccctggacttccacctcagccagagcgccctctactggaccgacgtggtggaggacaag
atctaccgcgggaagctgctggacaacggagccctgactagtttcgaggtggtgattcag
tatggcctggccacacccgagggcctggctgtagactggattgcaggcaacatctactgg
gtggagagtaacctggatcagatcgaggtggccaagctggatgggaccctccggaccacc
ctgctggccggtgacattgagcacccaagggcaatcgcactggatccccgggatgggatc
ctgttttggacagactgggatgccagcctgccccgcattgaggcagcctccatgagtggg
gctgggcgccgcaccgtgcaccgggagaccggctctgggggctggcccaacgggctcacc
gtggactacctggagaagcgcatcctttggattgacgccaggtcagatgccatttactca
gcccgttacgacggctctggccacatggaggtgcttcggggacacgagttcctgtcgcac
ccgtttgcagtgacgctgtacgggggggaggtctactggactgactggcgaacaaacaca
ctggctaaggccaacaagtggaccggccacaatgtcaccgtggtacagaggaccaacacc
cagccctttgacctgcaggtgtaccacccctcccgccagcccatggctcccaatccctgt
gaggccaatgggggccagggcccctgctcccacctgtgtctcatcaactacaaccggacc
gtgtcctgcgcctgcccccacctcatgaagctccacaaggacaacaccacctgctatgag
tttaagaagttcctgctgtacgcacgtcagatggagatccgaggtgtggacctggatgct
ccctactacaactacatcatctccttcacggtgcccgacatcgacaacgtcacagtgcta
gactacgatgcccgcgagcagcgtgtgtactggtctgacgtgcggacacaggccatcaag
cgggccttcatcaacggcacaggcgtggagacagtcgtctctgcagacttgccaaatgcc
cacgggctggctgtggactgggtctcccgaaacctgttctggacaagctatgacaccaat
aagaagcagatcaatgtggcccggctggatggctccttcaagaacgcagtggtgcagggc
ctggagcagccccatggccttgtcgtccaccctctgcgtgggaagctctactggaccgat
ggtgacaacatcagcatggccaacatggatggcagcaatcgcaccctgctcttcagtggc
cagaagggccccgtgggcctggctattgacttccctgaaagcaaactctactggatcagc
tccgggaaccataccatcaaccgctgcaacctggatgggagtgggctggaggtcatcgat
gccatgcggagccagctgggcaaggccaccgccctggccatcatgggggacaagctgtgg
tgggctgatcaggtgtcggaaaagatgggcacatgcagcaaggctgacggctcgggctcc
gtggtccttcggaacagcaccaccctggtgatgcacatgaaggtctatgacgagagcatc
cagctggaccataagggcaccaacccctgcagtgtcaacaacggtgactgctcccagctc
tgcctgcccacgtcagagacgacccgctcctgcatgtgcacagccggctatagcctccgg
agtggccagcaggcctgcgagggcgtaggttcctttctcctgtactctgtgcatgaggga
atcaggggaattcccctggatcccaatgacaagtcagatgccctggtcccagtgtccggg
acctcgctggctgtcggcatcgacttccacgctgaaaatgacaccatctactgggtggac
atgggcctgagcacgatcagccgggccaagcgggaccagacgtggcgtgaagacgtggtg
accaatggcattggccgtgtggagggcattgcagtggactggatcgcaggcaacatctac
tggacagaccagggctttgatgtcatcgaggtcgcccggctcaatggctccttccgctac
gtggtgatctcccagggtctagacaagccccgggccatcaccgtccacccggagaaaggg
tacttgttctggactgagtggggtcagtatccgcgtattgagcggtctcggctagatggc
acggagcgtgtggtgctggtcaacgtcagcatcagctggcccaacggcatctcagtggac
taccaggatgggaagctgtactggtgcgatgcacggacagacaagattgaacggatcgac
ctggagacaggtgagaaccgcgaggtggttctgtccagcaacaacatggacatgttttca
gtgtctgtgtttgaggatttcatctactggagtgacaggactcatgccaacggctctatc
aagcgcgggagcaaagacaatgccacagactccgtgcccctgcgaaccggcatcggcgtc
cagcttaaagacatcaaagtcttcaaccgggaccggcagaaaggcaccaacgtgtgcgcg
gtggccaatggcgggtgccagcagctgtgcctgtaccggggccgtgggcagcgggcctgc
gcctgtgcccacgggatgctggctgaagacggagcatcgtgccgcgagtatgccggctac
ctgctctactcagagcgcaccattctcaagagtatccacctgtcggatgagcgcaacctc
aatgcgcccgtgcagcccttcgaggaccctgagcacatgaagaacgtcatcgccctggcc
tttgactaccgggcaggcacctctccgggcacccccaatcgcatcttcttcagcgacatc
cactttgggaacatccaacagatcaacgacgatggctccaggaggatcaccattgtggaa
aacgtgggctccgtggaaggcctggcctatcaccgtggctgggacactctctattggaca
agctacacgacatccaccatcacgcgccacacagtggaccagacccgcccaggggccttc
gagcgtgagaccgtcatcactatgtctggagatgaccacccacgggccttcgttttggac
gagtgccagaacctcatgttctggaccaactggaatgagcagcatcccagcatcatgcgg
gcggcgctctcgggagccaatgtcctgacccttatcgagaaggacatccgtacccccaat
ggcctggccatcgaccaccgtgccgagaagctctacttctctgacgccaccctggacaag
atcgagcggtgcgagtatgacggctcccaccgctatgtgatcctaaagtcagagcctgtc
caccccttcgggctggccgtgtatggggagcacattttctggactgactgggtgcggcgg
gcagtgcagcgggccaacaagcacgtgggcagcaacatgaagctgctgcgcgtggacatc
ccccagcagcccatgggcatcatcgccgtggccaacgacaccaacagctgtgaactctct
ccatgccgaatcaacaacggtggctgccaggacctgtgtctgctcactcaccagggccat
gtcaactgctcatgccgagggggccgaatcctccaggatgacctcacctgccgagcggtg
aattcctcttgccgagcacaagatgagtttgagtgtgccaatggcgagtgcatcaacttc
agcctgacctgcgacggcgtcccccactgcaaggacaagtccgatgagaagccatcctac
tgcaactcccgccgctgcaagaagactttccggcagtgcagcaatgggcgctgtgtgtcc
aacatgctgtggtgcaacggggccgacgactgtggggatggctctgacgagatcccttgc
aacaagacagcctgtggtgtgggcgagttccgctgccgggacgggacctgcatcgggaac
tccagccgctgcaaccagtttgtggattgtgaggacgcctcagatgagatgaactgcagt
gccaccgactgcagcagctacttccgcctgggcgtgaagggcgtgctcttccagccctgc
gagcggacctcactctgctacgcacccagctgggtgtgtgatggcgccaatgactgtggg
gactacagtgatgagcgcgactgcccaggtgtgaaacgccccagatgccctctgaattac
ttcgcctgccctagtgggcgctgcatccccatgagctggacgtgtgacaaagaggatgac
tgtgaacatggcgaggacgagacccactgcaacaagttctgctcagaggcccagtttgag
tgccagaaccatcgctgcatctccaagcagtggctgtgtgacggcagcgatgactgtggg
gatggctcagacgaggctgctcactgtgaaggcaagacgtgcggcccctcctccttctcc
tgccctggcacccacgtgtgcgtccccgagcgctggctctgtgacggtgacaaagactgt
gctgatggtgcagacgagagcatcgcagctggttgcttgtacaacagcacttgtgacgac
cgtgagttcatgtgccagaaccgccagtgcatccccaagcacttcgtgtgtgaccacgac
cgtgactgtgcagatggctctgatgagtcccccgagtgtgagtacccgacctgcggcccc
agtgagttccgctgtgccaatgggcgctgtctgagctcccgccagtgggagtgtgatggc
gagaatgactgccacgaccagagtgacgaggctcccaagaacccacactgcaccagccaa
gagcacaagtgcaatgcctcgtcacagttcctgtgcagcagtgggcgctgtgtggctgag
gcactgctctgcaacggccaggatgactgtggcgacagctcggacgagcgtggctgccac
atcaatgagtgtctcagccgcaagctcagtggctgcagccaggactgtgaggacctcaag
atcggcttcaagtgccgctgtcgccctggcttccggctgaaggacgacggccggacgtgt
gctgatgtggacgagtgcagcaccaccttcccctgcagccagcgctgcatcaacactcat
ggcagctataagtgtctgtgtgtggagggctatgcaccccgcggcggcgacccccacagc
tgcaaggctgtgactgacgaggaaccgtttctgatcttcgccaaccggtactacctgcgc
aagctcaacctggacgggtccaactacacgttacttaagcagggcctgaacaacgccgtt
gccttggattttgactaccgagagcagatgatctactggacagatgtgaccacccagggc
agcatgatccgaaggatgcaccttaacgggagcaatgtgcaggtcctacaccgtacaggc
ctcagcaaccccgatgggctggctgtggactgggtgggtggcaacctgtactggtgcgac
aaaggccgggacaccatcgaggtgtccaagctcaatggggcctatcggacggtgctggtc
agctctggcctccgtgagcccagggctctggtggtggatgtgcagaatgggtacctgtac
tggacagactggggtgaccattcactgatcggccgcatcggcatggatgggtccagccgc
agcgtcatcgtggacaccaagatcacatggcccaatggcctgacgctggactatgtcact
gagcgcatctactgggccgacgcccgcgaggactacattgaatttgccagcctggatggc
tccaatcgccacgttgtgctgagccaggacatcccgcacatctttgcactgaccctgttt
gaggactacgtctactggaccgactgggaaacaaagtccattaaccgagcccacaagacc
acgggcaccaacaaaacgctcctcatcagcacgctgcaccggcccatggacctgcatgtc
ttccatgccctgcgccagccagacgtgcccaatcacccctgcaaggtcaacaatggtggc
tgcagcaacctgtgcctgctgtcccccgggggagggcacaaatgtgcctgccccaccaac
ttctacctgggcagcgatgggcgcacctgtgtgtccaactgcacggctagccagtttgta
tgcaagaacgacaagtgcatccccttctggtggaagtgtgacaccgaggacgactgcggg
gaccactcagacgagcccccggactgccctgagttcaagtgccggcccggacagttccag
tgctccacaggtatctgcacaaaccctgccttcatctgcgatggcgacaatgactgccag
gacaacagtgacgaggccaactgtgacatccacgtctgcttgcccagtcagttcaaatgc
accaacaccaaccgctgtattcccggcatcttccgctgcaatgggcaggacaactgcgga
gatggggaggatgagagggactgccccgaggtgacctgcgcccccaaccagttccagtgc
tccattaccaaacggtgcatcccccgggtctgggtctgcgaccgggacaatgactgtgtg
gatggcagtgatgagcccgccaactgcacccagatgacctgtggtgtggacgagttccgc
tgcaaggattcgggccgctgcatcccagcgcgttggaagtgtgacggagaggatgactgt
ggggatggctcggatgagcccaaggaagagtgtgatgaacgcacctgtgagccataccag
ttccgctgcaagaacaaccgctgcgtgcccggccgctggcagtgcgactacgacaacgat
tgcggtgacaactccgatgaagagagctgcacccctcggccctgctccgagagtgagttc
tcctgtgccaacggccgctgcatcgcggggcgctggaaatgcgatggagaccacgactgc
gcggacggctcggacgagaaagactgcaccccccgctgtgacatggaccagttccagtgc
aagagcggccactgcatccccctgcgctggcgctgtgacgcagacgccgactgcatggac
ggcagcgacgaggaggcctgcggcactggcgtgcggacctgccccctggacgagttccag
tgcaacaacaccttgtgcaagccgctggcctggaagtgcgatggcgaggatgactgtggg
gacaactcagatgagaaccccgaggagtgtgcccggttcgtgtgccctcccaaccggccc
ttccgttgcaagaatgaccgcgtctgtctgtggatcgggcgccaatgcgatggcacggac
aactgtggggatgggactgatgaagaggactgtgagccccccacagcccacaccacccac
tgcaaagacaagaaggagtttctgtgccggaaccagcgctgcctctcctcctccctgcgc
tgcaacatgttcgatgactgcggggacggctctgacgaggaggactgcagcatcgacccc
aagctgaccagctgcgccaccaatgccagcatctgtggggacgaggcacgctgcgtgcgc
accgagaaagcggcctactgtgcctgccgctcgggcttccacaccgtgcccggccagccc
ggatgccaagacatcaacgagtgcctgcgcttcggcacctgctcccagctctgcaacaac
accaagggcggccacctctgcagctgcgctcggaacttcatgaagacgcacaacacctgc
aaggccgaaggctctgagtaccaggtcctgtacatcgctgatgacaatgagatccgcagc
ctgttccccggccacccccattcggcttacgagcaggcattccagggtgacgagagtgtc
cgcattgatgctatggatgtccatgtcaaggctggccgtgtctattggaccaactggcac
acgggcaccatctcctaccgcagcctgccacctgctgcgcctcctaccacttccaaccgc
caccggcgacagattgaccggggtgtcacccacctcaacatttcagggctgaagatgccc
agaggcatcgccatcgactgggtggccggaaacgtgtactggaccgactcgggccgagat
gtgattgaggtggcgcagatgaagggcgagaaccgcaagacgctcatctcgggcatgatt
gacgagccccacgccattgtggtggacccactgagggggaccatgtactggtcagactgg
ggcaaccaccccaagattgagacggcagcgatggatgggacgcttcgggagacactggtg
caggacaacattcagtggcccacaggcctggccgtggattatcacaatgagcggctgtac
tgggcagacgccaagctttcagtcatcggcagcatccggctcaatggcacggaccccatt
gtggctgctgacagcaaacgaggcctaagtcaccccttcagcatcgacgtctttgaggat
tacatctatggtgtcacctacatcaataatcgtgtcttcaagatccataagtttggccac
agccccttggtcaacctgacagggggcctgagccacgcctctgacgtggtcctttaccat
cagcacaagcagcccgaagtgaccaacccatgtgaccgcaagaaatgcgagtggctctgc
ctgctgagccccagtgggcctgtctgcacctgtcccaatgggaagcggctggacaacggc
acatgcgtgcctgtgccctctccaacgccccccccagatgctccccggcctggaacctgt
aacctgcagtgcttcaacggtggcagctgtttcctcaatgcacggaggcagcccaagtgc
cgctgccaaccccgctacacgggtgacaagtgtgaactggaccagtgctgggagcactgt
cgcaatgggggcacctgtgctgcctccccctctggcatgcccacgtgccggtgccccacg
ggcttcacgggccccaaatgcacccagcaggtgtgtgcgggctactgtgccaacaacagc
acctgcactgtcaaccagggcaaccagccccagtgccgatgcctacccggcttcctgggc
gaccgctgccagtaccggcagtgctctggctactgtgagaactttggcacatgccagatg
gctgctgatggctcccgacaatgccgctgcactgcctactttgagggatcgaggtgtgag
gtgaacaagtgcagccgctgtctcgaaggggcctgtgtggtcaacaagcagagtggggat
gtcacctgcaactgcacggatggccgggtggcccccagctgtctgacctgcgtcggccac
tgcagcaatggcggctcctgtaccatgaacagcaaaatgatgcctgagtgccagtgccca
ccccacatgacagggccccggtgtgaggagcacgtcttcagccagcagcagccaggacat
atagcctccatcctaatccctctgctgttgctgctgctgctggttctggtggccggagtg
gtattctggtataagcggcgagtccaaggggctaagggcttccagcaccaacggatgacc
aacggggccatgaacgtggagattggaaaccccacctacaagatgtacgaaggcggagag
cctgatgatgtgggaggcctactggacgctgactttgccctggaccctgacaagcccacc
aacttcaccaaccccgtgtatgccacactctacatggggggccatggcagtcgccactcc
ctggccagcacggacgagaagcgagaactcctgggccggggccctgaggacgagataggg
gaccccttggcatag

DBGET integrated database retrieval system