KEGG   Homo sapiens (human): 4040Help
Entry
4040              CDS       T01001                                 

Gene name
LRP6, ADCAD2, STHAG7
Definition
(RefSeq) LDL receptor related protein 6
  KO
K03068  
low density lipoprotein receptor-related protein 5/6
Organism
hsa  Homo sapiens (human)
Pathway
mTOR signaling pathway
Wnt signaling pathway
Breast cancer
Hepatocellular carcinoma
Disease
H00625  
Tooth agenesis
H01742  
Coronary artery disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    4040 (LRP6)
   04150 mTOR signaling pathway
    4040 (LRP6)
 Human Diseases
  Cancers
   05225 Hepatocellular carcinoma
    4040 (LRP6)
   05224 Breast cancer
    4040 (LRP6)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Low-density lipoprotein receptor (LDLR) family proteins
    4040 (LRP6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Pharos: 
O75581(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
12p13.2
AA seq 1613 aa AA seqDB search
MGAVLRSLLACSFCVLLRAAPLLLYANRRDLRLVDATNGKENATIVVGGLEDAAAVDFVF
SHGLIYWSDVSEEAIKRTEFNKTESVQNVVVSGLLSPDGLACDWLGEKLYWTDSETNRIE
VSNLDGSLRKVLFWQELDQPRAIALDPSSGFMYWTDWGEVPKIERAGMDGSSRFIIINSE
IYWPNGLTLDYEEQKLYWADAKLNFIHKSNLDGTNRQAVVKGSLPHPFALTLFEDILYWT
DWSTHSILACNKYTGEGLREIHSDIFSPMDIHAFSQQRQPNATNPCGIDNGGCSHLCLMS
PVKPFYQCACPTGVKLLENGKTCKDGATELLLLARRTDLRRISLDTPDFTDIVLQLEDIR
HAIAIDYDPVEGYIYWTDDEVRAIRRSFIDGSGSQFVVTAQIAHPDGIAVDWVARNLYWT
DTGTDRIEVTRLNGTMRKILISEDLEEPRAIVLDPMVGYMYWTDWGEIPKIERAALDGSD
RVVLVNTSLGWPNGLALDYDEGKIYWGDAKTDKIEVMNTDGTGRRVLVEDKIPHIFGFTL
LGDYVYWTDWQRRSIERVHKRSAEREVIIDQLPDLMGLKATNVHRVIGSNPCAEENGGCS
HLCLYRPQGLRCACPIGFELISDMKTCIVPEAFLLFSRRADIRRISLETNNNNVAIPLTG
VKEASALDFDVTDNRIYWTDISLKTISRAFMNGSALEHVVEFGLDYPEGMAVDWLGKNLY
WADTGTNRIEVSKLDGQHRQVLVWKDLDSPRALALDPAEGFMYWTEWGGKPKIDRAAMDG
SERTTLVPNVGRANGLTIDYAKRRLYWTDLDTNLIESSNMLGLNREVIADDLPHPFGLTQ
YQDYIYWTDWSRRSIERANKTSGQNRTIIQGHLDYVMDILVFHSSRQSGWNECASSNGHC
SHLCLAVPVGGFVCGCPAHYSLNADNRTCSAPTTFLLFSQKSAINRMVIDEQQSPDIILP
IHSLRNVRAIDYDPLDKQLYWIDSRQNMIRKAQEDGSQGFTVVVSSVPSQNLEIQPYDLS
IDIYSRYIYWTCEATNVINVTRLDGRSVGVVLKGEQDRPRAVVVNPEKGYMYFTNLQERS
PKIERAALDGTEREVLFFSGLSKPIALALDSRLGKLFWADSDLRRIESSDLSGANRIVLE
DSNILQPVGLTVFENWLYWIDKQQQMIEKIDMTGREGRTKVQARIAQLSDIHAVKELNLQ
EYRQHPCAQDNGGCSHICLVKGDGTTRCSCPMHLVLLQDELSCGEPPTCSPQQFTCFTGE
IDCIPVAWRCDGFTECEDHSDELNCPVCSESQFQCASGQCIDGALRCNGDANCQDKSDEK
NCEVLCLIDQFRCANGQCIGKHKKCDHNVDCSDKSDELDCYPTEEPAPQATNTVGSVIGV
IVTIFVSGTVYFICQRMLCPRMKGDGETMTNDYVVHGPASVPLGYVPHPSSLSGSLPGMS
RGKSMISSLSIMGGSSGPPYDRAHVTGASSSSSSSTKGTYFPAILNPPPSPATERSHYTM
EFGYSSNSPSTHRSYSYRPYSYRHFAPPTTPCSTDVCDSDYAPSRRMTSVATAKGYTSDL
NYDSEPVPPPPTPRSQYLSAEENYESCPPSPYTERSYSHHLYPPPPSPCTDSS
NT seq 4842 nt NT seq  +upstreamnt  +downstreamnt
atgggggccgtcctgaggagcctcctggcctgcagcttctgtgtgctcctgagagcggcc
cctttgttgctttatgcaaacagacgggacttgcgattggttgatgctacaaatggcaaa
gagaatgctacgattgtagttggaggcttggaggatgcagctgcggtggactttgtgttt
agtcatggcttgatatactggagtgatgtcagcgaagaagccattaaacgaacagaattt
aacaaaactgagagtgtgcagaatgttgttgtttctggattattgtcccccgatgggctg
gcatgtgattggcttggagaaaaattgtactggacagattctgaaactaatcggattgaa
gtttctaatttagatggatctttacgaaaagttttattttggcaagagttggatcaaccc
agagctattgccttagatccttcaagtgggttcatgtactggacagactggggagaagtg
ccaaagatagaacgtgctggaatggatggttcaagtcgcttcattataataaacagtgaa
atttactggccaaatggactgactttggattatgaagaacaaaagctttattgggcagat
gcaaaacttaatttcatccacaaatcaaatctggatggaacaaatcggcaggcagtggtt
aaaggttcccttccacatccttttgccttgacgttatttgaggacatattgtactggact
gactggagcacacactccattttggcttgcaacaagtatactggtgagggtctgcgtgaa
atccattctgacatcttctctcccatggatatacatgccttcagccaacagaggcagcca
aatgccacaaatccatgtggaattgacaatgggggttgttcccatttgtgtttgatgtct
ccagtcaagcctttttatcagtgtgcttgccccactggggtcaaactcctggagaatgga
aaaacctgcaaagatggtgccacagaattattgcttttagctcgaaggacagacttgaga
cgcatttctttggatacaccagattttacagacattgttctgcagttagaagacatccgt
catgccattgccatagattacgatcctgtggaaggctacatctactggactgatgatgaa
gtgagggccatacgccgttcatttatagatggatctggcagtcagtttgtggtcactgct
caaattgcccatcctgatggtattgctgtggactgggttgcacgaaatctttattggaca
gacactggcactgatcgaatagaagtgacaaggctcaatgggaccatgaggaagatcttg
atttcagaggacttagaggaaccccgggctattgtgttagatcccatggttgggtacatg
tattggactgactggggagaaattccgaaaattgagcgagcagctctggatggttctgac
cgtgtagtattggttaacacttctcttggttggccaaatggtttagccttggattatgat
gaaggcaaaatatactggggagatgccaaaacagacaagattgaggttatgaatactgat
ggcactgggagacgagtactagtggaagacaaaattcctcacatatttggatttactttg
ttgggtgactatgtttactggactgactggcagaggcgtagcattgaaagagttcataaa
cgaagtgcagagagggaagtgatcatagatcagctgcctgacctcatgggcctaaaggct
acaaatgttcatcgagtgattggttccaacccctgtgctgaggaaaacgggggatgtagc
catctctgcctctatagacctcagggccttcgctgtgcttgccctattggctttgaactc
atcagtgacatgaagacctgcattgtcccagaggctttccttttgttttcacggagagca
gatatcagacgaatttctctggaaacaaacaataataatgtggctattccactcactggt
gtcaaagaagcttctgctttggattttgatgtgacagacaaccgaatttattggactgat
atatcactcaagaccatcagcagagcctttatgaatggcagtgcactggaacatgtggta
gaattcggcttagattatccagaaggcatggcagtagactggcttgggaagaacttgtac
tgggcagacacaggaacgaatcgaattgaggtgtcaaagttggatgggcagcaccgacaa
gttttggtgtggaaagacctagatagtcccagagctctcgcgttggaccctgccgaagga
tttatgtattggactgaatggggtggaaaacctaagatagacagagctgcaatggatgga
agtgaacgtactaccttagttccaaatgtggggcgggcaaacggcctaactattgattat
gctaaaaggaggctttattggacagacctggacaccaacttaatagaatcttcaaatatg
cttgggctcaaccgtgaagttatagcagatgacttgcctcatccttttggcttaactcag
taccaagattatatctactggacggactggagccgacgcagcattgagcgtgccaacaaa
accagtggccaaaaccgcaccatcattcagggccatttggattatgtgatggacatcctc
gtctttcactcatctcgacagtcagggtggaatgaatgtgcttccagcaatgggcactgc
tcccacctctgcttggctgtgccagttgggggttttgtttgtggatgccctgcccactac
tctcttaatgctgacaacaggacttgtagtgctcctacgactttcctgctcttcagtcaa
aagagtgccatcaaccgcatggtgattgatgaacaacagagccccgacatcatccttccc
atccacagccttcggaatgtccgggccattgactatgacccactggacaagcaactctat
tggattgactcacgacaaaacatgatccgaaaggcacaagaagatggcagccagggcttt
actgtggttgtgagctcagttccgagtcagaacctggaaatacaaccctatgacctcagc
attgatatttacagccgctacatctactggacttgtgaggctaccaatgtcattaatgtg
acaagattagatgggagatcagttggagtggtgctgaaaggcgagcaggacagacctcga
gccgttgtggtaaacccagagaaagggtatatgtattttaccaatcttcaggaaaggtct
cctaaaattgaacgggctgctttggatgggacagaacgggaggtcctctttttcagtggc
ttaagtaaaccaattgctttagcccttgatagcaggctgggcaagctcttttgggctgat
tcagatctccggcgaattgaaagcagtgatctctcaggtgctaaccggatagtattagaa
gactccaatatcttgcagcctgtgggacttactgtgtttgaaaactggctctattggatt
gataaacagcagcaaatgattgaaaaaattgacatgacaggtcgagagggtagaaccaaa
gtccaagctcgaattgcccagcttagtgacattcatgcagtaaaggagctgaaccttcaa
gaatacagacagcacccttgtgctcaggataatggtggctgttcacatatttgtcttgta
aagggggatggtactacaaggtgttcttgccccatgcacctggttctacttcaagatgag
ctatcatgtggagaacctccaacatgttctcctcagcagtttacttgtttcacgggggaa
attgactgtatccctgtggcttggcggtgcgatgggtttactgaatgtgaagaccacagt
gatgaactcaattgtcctgtatgctcagagtcccagttccagtgtgccagtgggcagtgt
attgatggtgccctccgatgcaatggagatgcaaactgccaggacaaatcagatgagaag
aactgtgaagtgctttgtttaattgatcagttccgctgtgccaatggtcagtgcattgga
aagcacaagaagtgtgatcataatgtggattgcagtgacaagtcagatgaactggattgt
tatccgactgaagaaccagcaccacaggccaccaatacagttggttctgttattggcgta
attgtcaccatttttgtgtctggaactgtatactttatctgccagaggatgttgtgtcca
cgtatgaagggagatggggaaactatgactaatgactatgtagttcatggaccagcttct
gtgcctcttggttatgtgccacacccaagttctttgtcaggatctcttccaggaatgtct
cgaggtaaatcaatgatcagctccctcagtatcatggggggaagcagtggacccccctat
gaccgagcccatgttacaggagcatcatcaagtagttcttcaagcaccaaaggcacttac
ttccctgcaattttgaaccctccaccatccccagccacagagcgatcacattacactatg
gaatttggatattcttcaaacagtccttccactcataggtcatacagctacaggccatat
agctaccggcactttgcaccccccaccacaccctgcagcacagatgtttgtgacagtgac
tatgctcctagtcggagaatgacctcagtggcaacagccaagggctataccagtgacttg
aactatgattcagaacctgtgcccccacctcccacaccccgaagccaatacttgtcagca
gaggagaactatgaaagctgcccaccttctccatacacagagaggagctattctcatcac
ctctacccaccgccaccctctccctgtacagactcctcctga

DBGET integrated database retrieval system