KEGG   Homo sapiens (human): 4049Help
Entry
4049              CDS       T01001                                 

Gene name
LTA, LT, TNFB, TNFSF1, TNLG1E
Definition
(RefSeq) lymphotoxin alpha
  KO
K05468  lymphotoxin alpha (TNF superfamily, member 1)
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04064  NF-kappa B signaling pathway
hsa04668  TNF signaling pathway
hsa04940  Type I diabetes mellitus
hsa05166  HTLV-I infection
hsa05168  Herpes simplex infection
Disease
H00344  Leprosy
Drug target
Etanercept: D00742
Lenercept: D04690
Pateclizumab: D10187
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04064 NF-kappa B signaling pathway
    4049 (LTA)
   04668 TNF signaling pathway
    4049 (LTA)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    4049 (LTA)
 Human Diseases
  Endocrine and metabolic diseases
   04940 Type I diabetes mellitus
    4049 (LTA)
  Infectious diseases
   05166 HTLV-I infection
    4049 (LTA)
   05168 Herpes simplex infection
    4049 (LTA)
Cytokines [BR:hsa04052]
 TNF family
  4049 (LTA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TNF
Motif
Other DBs
NCBI-GeneID: 4049
NCBI-ProteinID: NP_000586
OMIM: 153440
HGNC: 6709
Ensembl: ENSG00000226979
Vega: OTTHUMG00000031135
Pharos: P01374(Tbio)
UniProt: P01374 Q5STV3
Structure
PDB: 

Jmol
Position
6p21.33
AA seq 205 aa AA seqDB search
MTPPERLFLPRVCGTTLHLLLLGLLLVLLPGAQGLPGVGLTPSAAQTARQHPKMHLAHST
LKPAAHLIGDPSKQNSLLWRANTDRAFLQDGFSLSNNSLLVPTSGIYFVYSQVVFSGKAY
SPKATSSPLYLAHEVQLFSSQYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQLTQGDQ
LSTHTDGIPHLVLSPSTVFFGAFAL
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgacaccacctgaacgtctcttcctcccaagggtgtgtggcaccaccctacacctcctc
cttctggggctgctgctggttctgctgcctggggcccaggggctccctggtgttggcctc
acaccttcagctgcccagactgcccgtcagcaccccaagatgcatcttgcccacagcacc
ctcaaacctgctgctcacctcattggagaccccagcaagcagaactcactgctctggaga
gcaaacacggaccgtgccttcctccaggatggtttctccttgagcaacaattctctcctg
gtccccaccagtggcatctacttcgtctactcccaggtggtcttctctgggaaagcctac
tctcccaaggccacctcctccccactctacctggcccatgaggtccagctcttctcctcc
cagtaccccttccatgtgcctctcctcagctcccagaagatggtgtatccagggctgcag
gaaccctggctgcactcgatgtaccacggggctgcgttccagctcacccagggagaccag
ctatccacccacacagatggcatcccccacctagtcctcagccctagtactgtcttcttt
ggagccttcgctctgtag

DBGET integrated database retrieval system