KEGG   Homo sapiens (human): 4049Help
Entry
4049              CDS       T01001                                 

Gene name
LTA, LT, TNFB, TNFSF1
Definition
lymphotoxin alpha
Orthology
K05468  
lymphotoxin alpha (TNF superfamily, member 1)
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
NF-kappa B signaling pathway
TNF signaling pathway
Type I diabetes mellitus
HTLV-I infection
Herpes simplex infection
Disease
H00344  
Leprosy
Drug target
Etanercept: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04064 NF-kappa B signaling pathway
    4049 (LTA)
   04668 TNF signaling pathway
    4049 (LTA)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    4049 (LTA)
 Human Diseases
  Endocrine and metabolic diseases
   04940 Type I diabetes mellitus
    4049 (LTA)
  Infectious diseases
   05166 HTLV-I infection
    4049 (LTA)
   05168 Herpes simplex infection
    4049 (LTA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
6p21.3
AA seq 205 aa AA seqDB search
MTPPERLFLPRVCGTTLHLLLLGLLLVLLPGAQGLPGVGLTPSAAQTARQHPKMHLAHST
LKPAAHLIGDPSKQNSLLWRANTDRAFLQDGFSLSNNSLLVPTSGIYFVYSQVVFSGKAY
SPKATSSPLYLAHEVQLFSSQYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQLTQGDQ
LSTHTDGIPHLVLSPSTVFFGAFAL
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgacaccacctgaacgtctcttcctcccaagggtgtgtggcaccaccctacacctcctc
cttctggggctgctgctggttctgctgcctggggcccaggggctccctggtgttggcctc
acaccttcagctgcccagactgcccgtcagcaccccaagatgcatcttgcccacagcacc
ctcaaacctgctgctcacctcattggagaccccagcaagcagaactcactgctctggaga
gcaaacacggaccgtgccttcctccaggatggtttctccttgagcaacaattctctcctg
gtccccaccagtggcatctacttcgtctactcccaggtggtcttctctgggaaagcctac
tctcccaaggccacctcctccccactctacctggcccatgaggtccagctcttctcctcc
cagtaccccttccatgtgcctctcctcagctcccagaagatggtgtatccagggctgcag
gaaccctggctgcactcgatgtaccacggggctgcgttccagctcacccagggagaccag
ctatccacccacacagatggcatcccccacctagtcctcagccctagtactgtcttcttt
ggagccttcgctctgtag

DBGET integrated database retrieval system