KEGG   Homo sapiens (human): 405Help
Entry
405               CDS       T01001                                 

Gene name
ARNT, HIF-1-beta, HIF-1beta, HIF1-beta, HIF1B, HIF1BETA, TANGO, bHLHe2
Definition
aryl hydrocarbon receptor nuclear translocator
Orthology
K09097  
aryl hydrocarbon receptor nuclear translocator
Organism
hsa  Homo sapiens (human)
Pathway
HIF-1 signaling pathway
Pathways in cancer
Chemical carcinogenesis
Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04066 HIF-1 signaling pathway
    405 (ARNT)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    405 (ARNT)
   05204 Chemical carcinogenesis
    405 (ARNT)
   05211 Renal cell carcinoma
    405 (ARNT)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    405 (ARNT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1q21
AA seq 773 aa AA seqDB search
MAATTANPEMTSDVPSLGPAIASGNSGPGIQGGGAIVQRAIKRRPGLDFDDDGEGNSKFL
RCDDDQMSNDKERFARENHSEIERRRRNKMTAYITELSDMVPTCSALARKPDKLTILRMA
VSHMKSLRGTGNTSTDGSYKPSFLTDQELKHLILEAADGFLFIVSCETGRVVYVSDSVTP
VLNQPQSEWFGSTLYDQVHPDDVDKLREQLSTSENALTGRILDLKTGTVKKEGQQSSMRM
CMGSRRSFICRMRCGSSSVDPVSVNRLSFVRNRCRNGLGSVKDGEPHFVVVHCTGYIKAW
PPAGVSLPDDDPEAGQGSKFCLVAIGRLQVTSSPNCTDMSNVCQPTEFISRHNIEGIFTF
VDHRCVATVGYQPQELLGKNIVEFCHPEDQQLLRDSFQQVVKLKGQVLSVMFRFRSKNQE
WLWMRTSSFTFQNPYSDEIEYIICTNTNVKNSSQEPRPTLSNTIQRPQLGPTANLPLEMG
SGQLAPRQQQQQTELDMVPGRDGLASYNHSQVVQPVTTTGPEHSKPLEKSDGLFAQDRDP
RFSEIYHNINADQSKGISSSTVPATQQLFSQGNTFPPTPRPAENFRNSGLAPPVTIVQPS
ASAGQMLAQISRHSNPTQGATPTWTPTTRSGFSAQVATQATAKTRTSQFGVGSFQTPSSF
SSMSLPGAPTASPGAAAYPSLTNRGSNFAPETGQTAGQFQTRTAEGVGVWPQWQGQQPHH
RSSSSEQHVQQPPAQQPGQPEVFQEMLSMLGDQSNSYNNEEFPDLTMFPPFSE
NT seq 2322 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgactactgccaaccccgaaatgacatcagatgtaccatcactgggtccagcc
attgcctctggaaactctggacctggaattcaaggtggaggagccattgtccagagggct
attaagcggcgaccagggctggattttgatgatgatggagaagggaacagtaaatttttg
aggtgtgatgatgatcagatgtctaacgataaggagcggtttgccagggaaaatcacagt
gaaattgaacggcggcgacggaacaagatgacagcctacatcacagaactgtcagatatg
gtacccacctgtagtgccctggctcgaaaaccagacaagctaaccatcttacgcatggca
gtttctcacatgaagtccttgcggggaactggcaacacatccactgatggctcctataag
ccgtctttcctcactgatcaggaactgaaacatttgatcttggaggcagcagatggcttt
ctgtttattgtctcatgtgagacaggcagggtggtgtatgtgtctgactccgtgactcct
gttttgaaccagccacagtctgaatggtttggcagcacactctatgatcaggtgcaccca
gatgatgtggataaacttcgtgagcagctttccacttcagaaaatgccctgacagggcgt
atcctggatctaaagactggaacagtgaaaaaggaaggtcagcagtcttccatgagaatg
tgtatgggctcaaggagatcgtttatttgccgaatgaggtgtggcagtagctctgtggac
ccagtttctgtgaataggctgagctttgtgaggaacagatgcaggaatggacttggctct
gtaaaggatggggaacctcacttcgtggtggtccactgcacaggctacatcaaggcctgg
cccccagcaggtgtttccctcccagatgatgacccagaggctggccagggaagcaagttt
tgcctagtggccattggcagattgcaggtaactagttctcccaactgtacagacatgagt
aatgtttgtcaaccaacagagttcatctcccgacacaacattgagggtatcttcactttt
gtggatcaccgctgtgtggctactgttggctaccagccacaggaactcttaggaaagaat
attgtagaattctgtcatcctgaagaccagcagcttctaagagacagcttccaacaggta
gtgaaattaaaaggccaagtgctgtctgtcatgttccggttccggtctaagaaccaagaa
tggctctggatgagaaccagctcctttactttccagaacccttactcagatgaaattgag
tacatcatctgtaccaacaccaatgtgaagaactctagccaagaaccacggcctacactc
tccaacacaatccagaggccacaactaggtcccacagctaatttacccctggagatgggc
tcaggacagctggcacccaggcagcagcaacagcaaacagaattggacatggtaccagga
agagatggactggccagctacaatcattcccaggtggttcagcctgtgacaaccacagga
ccagaacacagcaagccccttgagaagtcagatggtttatttgcccaggatagagatcca
agattttcagaaatctatcacaacatcaatgcggatcagagtaaaggcatctcctccagc
actgtccctgccacccaacagctattctcccagggcaacacattccctcctaccccccgg
ccggcagagaatttcaggaatagtggcctagcccctcctgtaaccattgtccagccatca
gcttctgcaggacagatgttggcccagatttcccgccactccaaccccacccaaggagca
accccaacttggacccctactacccgctcaggcttttctgcccaggtggctacccaggct
actgctaagactcgtacttcccagtttggtgtgggcagctttcagactccatcctccttc
agctccatgtccctccctggtgccccaactgcatcgcctggtgctgctgcctaccctagt
ctcaccaatcgtggatctaactttgctcctgagactggacagactgcaggacaattccag
acacggacagcagagggtgtgggtgtctggccacagtggcagggccagcagcctcatcat
cgttcaagttctagtgagcaacatgttcaacaaccgccagcacagcaacctggccagcct
gaggtcttccaggagatgctgtccatgctgggagatcagagcaacagctacaacaatgaa
gaattccctgatctaactatgtttccccccttttcagaatag

DBGET integrated database retrieval system