KEGG   Homo sapiens (human): 405Help
Entry
405               CDS       T01001                                 

Gene name
ARNT, HIF-1-beta, HIF-1beta, HIF1-beta, HIF1B, HIF1BETA, TANGO, bHLHe2
Definition
(RefSeq) aryl hydrocarbon receptor nuclear translocator
  KO
K09097  aryl hydrocarbon receptor nuclear translocator
Organism
hsa  Homo sapiens (human)
Pathway
hsa04066  HIF-1 signaling pathway
hsa04934  Cushing's syndrome
hsa05200  Pathways in cancer
hsa05204  Chemical carcinogenesis
hsa05211  Renal cell carcinoma
Network
N00079  HIF-1 signaling pathway
N00080  Loss of VHL to HIF-1 signaling pathway
N00081  Mutation-inactivated VHL to HIF-1 signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04066 HIF-1 signaling pathway
    405 (ARNT)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    405 (ARNT)
   05204 Chemical carcinogenesis
    405 (ARNT)
   05211 Renal cell carcinoma
    405 (ARNT)
  Endocrine and metabolic diseases
   04934 Cushing's syndrome
    405 (ARNT)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    405 (ARNT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PAS_3 PAS PAS_11 HLH PAS_9 PAS_4 PRAS
Motif
Other DBs
NCBI-GeneID: 405
NCBI-ProteinID: NP_001659
OMIM: 126110
HGNC: 700
Ensembl: ENSG00000143437
Vega: OTTHUMG00000035011
Pharos: P27540(Tbio)
UniProt: P27540
Structure
PDB: 

Jmol
Position
1q21.3
AA seq 789 aa AA seqDB search
MAATTANPEMTSDVPSLGPAIASGNSGPGIQGGGAIVQRAIKRRPGLDFDDDGEGNSKFL
RCDDDQMSNDKERFARSDDEQSSADKERLARENHSEIERRRRNKMTAYITELSDMVPTCS
ALARKPDKLTILRMAVSHMKSLRGTGNTSTDGSYKPSFLTDQELKHLILEAADGFLFIVS
CETGRVVYVSDSVTPVLNQPQSEWFGSTLYDQVHPDDVDKLREQLSTSENALTGRILDLK
TGTVKKEGQQSSMRMCMGSRRSFICRMRCGSSSVDPVSVNRLSFVRNRCRNGLGSVKDGE
PHFVVVHCTGYIKAWPPAGVSLPDDDPEAGQGSKFCLVAIGRLQVTSSPNCTDMSNVCQP
TEFISRHNIEGIFTFVDHRCVATVGYQPQELLGKNIVEFCHPEDQQLLRDSFQQVVKLKG
QVLSVMFRFRSKNQEWLWMRTSSFTFQNPYSDEIEYIICTNTNVKNSSQEPRPTLSNTIQ
RPQLGPTANLPLEMGSGQLAPRQQQQQTELDMVPGRDGLASYNHSQVVQPVTTTGPEHSK
PLEKSDGLFAQDRDPRFSEIYHNINADQSKGISSSTVPATQQLFSQGNTFPPTPRPAENF
RNSGLAPPVTIVQPSASAGQMLAQISRHSNPTQGATPTWTPTTRSGFSAQQVATQATAKT
RTSQFGVGSFQTPSSFSSMSLPGAPTASPGAAAYPSLTNRGSNFAPETGQTAGQFQTRTA
EGVGVWPQWQGQQPHHRSSSSEQHVQQPPAQQPGQPEVFQEMLSMLGDQSNSYNNEEFPD
LTMFPPFSE
NT seq 2370 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgactactgccaaccccgaaatgacatcagatgtaccatcactgggtccagcc
attgcctctggaaactctggacctggaattcaaggtggaggagccattgtccagagggct
attaagcggcgaccagggctggattttgatgatgatggagaagggaacagtaaatttttg
aggtgtgatgatgatcagatgtctaacgataaggagcggtttgccaggtcggatgatgag
cagagctctgcggataaagagagacttgccagggaaaatcacagtgaaattgaacggcgg
cgacggaacaagatgacagcctacatcacagaactgtcagatatggtacccacctgtagt
gccctggctcgaaaaccagacaagctaaccatcttacgcatggcagtttctcacatgaag
tccttgcggggaactggcaacacatccactgatggctcctataagccgtctttcctcact
gatcaggaactgaaacatttgatcttggaggcagcagatggctttctgtttattgtctca
tgtgagacaggcagggtggtgtatgtgtctgactccgtgactcctgttttgaaccagcca
cagtctgaatggtttggcagcacactctatgatcaggtgcacccagatgatgtggataaa
cttcgtgagcagctttccacttcagaaaatgccctgacagggcgtatcctggatctaaag
actggaacagtgaaaaaggaaggtcagcagtcttccatgagaatgtgtatgggctcaagg
agatcgtttatttgccgaatgaggtgtggcagtagctctgtggacccagtttctgtgaat
aggctgagctttgtgaggaacagatgcaggaatggacttggctctgtaaaggatggggaa
cctcacttcgtggtggtccactgcacaggctacatcaaggcctggcccccagcaggtgtt
tccctcccagatgatgacccagaggctggccagggaagcaagttttgcctagtggccatt
ggcagattgcaggtaactagttctcccaactgtacagacatgagtaatgtttgtcaacca
acagagttcatctcccgacacaacattgagggtatcttcacttttgtggatcaccgctgt
gtggctactgttggctaccagccacaggaactcttaggaaagaatattgtagaattctgt
catcctgaagaccagcagcttctaagagacagcttccaacaggtagtgaaattaaaaggc
caagtgctgtctgtcatgttccggttccggtctaagaaccaagaatggctctggatgaga
accagctcctttactttccagaacccttactcagatgaaattgagtacatcatctgtacc
aacaccaatgtgaagaactctagccaagaaccacggcctacactctccaacacaatccag
aggccacaactaggtcccacagctaatttacccctggagatgggctcaggacagctggca
cccaggcagcagcaacagcaaacagaattggacatggtaccaggaagagatggactggcc
agctacaatcattcccaggtggttcagcctgtgacaaccacaggaccagaacacagcaag
ccccttgagaagtcagatggtttatttgcccaggatagagatccaagattttcagaaatc
tatcacaacatcaatgcggatcagagtaaaggcatctcctccagcactgtccctgccacc
caacagctattctcccagggcaacacattccctcctaccccccggccggcagagaatttc
aggaatagtggcctagcccctcctgtaaccattgtccagccatcagcttctgcaggacag
atgttggcccagatttcccgccactccaaccccacccaaggagcaaccccaacttggacc
cctactacccgctcaggcttttctgcccagcaggtggctacccaggctactgctaagact
cgtacttcccagtttggtgtgggcagctttcagactccatcctccttcagctccatgtcc
ctccctggtgccccaactgcatcgcctggtgctgctgcctaccctagtctcaccaatcgt
ggatctaactttgctcctgagactggacagactgcaggacaattccagacacggacagca
gagggtgtgggtgtctggccacagtggcagggccagcagcctcatcatcgttcaagttct
agtgagcaacatgttcaacaaccgccagcacagcaacctggccagcctgaggtcttccag
gagatgctgtccatgctgggagatcagagcaacagctacaacaatgaagaattccctgat
ctaactatgtttccccccttttcagaatag

DBGET integrated database retrieval system