KEGG   Homo sapiens (human): 4052Help
Entry
4052              CDS       T01001                                 

Gene name
LTBP1
Definition
(RefSeq) latent transforming growth factor beta binding protein 1
  KO
K19559  
latent transforming growth factor beta binding protein 1
Organism
hsa  Homo sapiens (human)
Pathway
TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04350 TGF-beta signaling pathway
    4052 (LTBP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
2p22-p21
AA seq 1721 aa AA seqDB search
MAGAWLRWGLLLWAGLLASSAHGRLRRITYVVHPGPGLAAGALPLSGPPRSRTFNVALNA
RYSRSSAAAGAPSRASPGVPSERTRRTSKPGGAALQGLRPPPPPPPEPARPAVPGGQLHP
NPGGHPAAAPFTKQGRQVVRSKVPQETQSGGGSRLQVHQKQQLQGVNVCGGRCCHGWSKA
PGSQRCTKPSCVPPCQNGGMCLRPQLCVCKPGTKGKACETIAAQDTSSPVFGGQSPGAAS
SWGPPEQAAKHTSSKKADTLPRVSPVAQMTLTLKPKPSVGLPQQIHSQVTPLSSQSVVIH
HGQTQEYVLKPKYFPAQKGISGEQSTEGSFPLRYVQDQVAAPFQLSNHTGRIKVVFTPSI
CKVTCTKGSCQNSCEKGNTTTLISENGHAADTLTATNFRVVICHLPCMNGGQCSSRDKCQ
CPPNFTGKLCQIPVHGASVPKLYQHSQQPGKALGTHVIHSTHTLPLTVTSQQGVKVKFPP
NIVNIHVKHPPEASVQIHQVSRIDGPTGQKTKEAQPGQSQVSYQGLPVQKTQTIHSTYSH
QQVIPHVYPVAAKTQLGRCFQETIGSQCGKALPGLSKQEDCCGTVGTSWGFNKCQKCPKK
PSYHGYNQMMECLPGYKRVNNTFCQDINECQLQGVCPNGECLNTMGSYRCTCKIGFGPDP
TFSSCVPDPPVISEEKGPCYRLVSSGRQCMHPLSVHLTKQLCCCSVGKAWGPHCEKCPLP
GTAAFKEICPGGMGYTVSGVHRRRPIHHHVGKGPVFVKPKNTQPVAKSTHPPPLPAKEEP
VEALTFSREHGPGVAEPEVATAPPEKEIPSLDQEKTKLEPGQPQLSPGISTIHLHPQFPV
VIEKTSPPVPVEVAPEASTSSASQVIAPTQVTEINECTVNPDICGAGHCINLPVRYTCIC
YEGYRFSEQQRKCVDIDECTQVQHLCSQGRCENTEGSFLCICPAGFMASEEGTNCIDVDE
CLRPDVCGEGHCVNTVGAFRCEYCDSGYRMTQRGRCEDIDECLNPSTCPDEQCVNSPGSY
QCVPCTEGFRGWNGQCLDVDECLEPNVCANGDCSNLEGSYMCSCHKGYTRTPDHKHCRDI
DECQQGNLCVNGQCKNTEGSFRCTCGQGYQLSAAKDQCEDIDECQHRHLCAHGQCRNTEG
SFQCVCDQGYRASGLGDHCEDINECLEDKSVCQRGDCINTAGSYDCTCPDGFQLDDNKTC
QDINECEHPGLCGPQGECLNTEGSFHCVCQQGFSISADGRTCEDIDECVNNTVCDSHGFC
DNTAGSFRCLCYQGFQAPQDGQGCVDVNECELLSGVCGEAFCENVEGSFLCVCADENQEY
SPMTGQCRSRTSTDLDVDVDQPKEEKKECYYNLNDASLCDNVLAPNVTKQECCCTSGAGW
GDNCEIFPCPVLGTAEFTEMCPKGKGFVPAGESSSEAGGENYKDADECLLFGQEICKNGF
CLNTRPGYECYCKQGTYYDPVKLQCFDMDECQDPSSCIDGQCVNTEGSYNCFCTHPMVLD
ASEKRCIRPAESNEQIEETDVYQDLCWEHLSDEYVCSRPLVGKQTTYTECCCLYGEAWGM
QCALCPLKDSDDYAQLCNIPVTGRRQPYGRDALVDFSEQYTPEADPYFIQDRFLNSFEEL
QAEECGILNGCENGRCVRVQEGYTCDCFDGYHLDTAKMTCVDVNECDELNNRMSLCKNAK
CINTDGSYKCLCLPGYVPSDKPNYCTPLNTALNLEKDSDLE
NT seq 5166 nt NT seq  +upstreamnt  +downstreamnt
atggcgggggcctggctcaggtgggggctcctgctctgggcagggctcctcgcgtcctcg
gcgcacggccggctgcggaggatcacctacgtggtgcacccgggccccggcctggcagcc
ggcgccttgcccctgagcgggcccccgcgttcgcggacattcaacgtcgcgctcaacgcc
aggtacagccgcagctcggcggctgccggcgcccccagccgtgcctcccccggggtcccc
tcggagaggacccggcgcacgagcaagccgggcggcgcggccctgcaggggctcagaccg
ccgccgccgccgccgccggagcctgcgcgtcccgcggtccccggcgggcagctccacccc
aatcccggcggccacccggcagccgccccgttcaccaaacaaggcaggcaagttgtgcgc
tccaaggtgccgcaggagacccagagcggcggaggctctaggctgcaggttcaccagaag
cagcagctgcagggggtcaatgtctgtggagggcggtgctgtcatggctggagtaaggcc
cctggctcccagaggtgcaccaaacctagctgtgttccgccatgtcagaatggagggatg
tgtctccggccacaactctgtgtgtgtaaaccagggaccaagggcaaagcctgtgaaaca
atagctgcccaggacacctcgtcaccagtctttggagggcagagtcctggggctgcttcc
tcgtggggccctcctgagcaagcagcaaagcatacttcatctaagaaggcagacactcta
ccaagagtcagccctgtggcccagatgaccttaaccctcaagccgaagccttcagtggga
ctcccccagcagatacattctcaagtgactcctctttcttcccagagtgtggtgattcac
catggccagacccaggaatacgtgctcaagcccaagtactttccagcccagaaggggatt
tcaggagagcagtccactgaaggttctttccctttaagatatgtgcaggatcaagttgcg
gcaccttttcagctgagtaaccacactggccgcatcaaggtggtctttactccgagcatc
tgtaaagtgacctgcaccaagggcagctgtcagaacagctgtgagaaggggaacaccacc
actctcattagtgagaatggtcatgctgccgacaccctgacggccacgaacttccgagtg
gtaatttgccatcttccatgtatgaatggtggccagtgcagttcaagggacaaatgtcag
tgccctccaaatttcacaggaaaactttgtcagatcccagtccatggtgccagcgtgcct
aaactttatcagcattcccagcagccaggcaaggcgttggggacgcatgtcatccattca
acacataccttgcctctgaccgtgactagccagcaaggagtcaaagtgaaatttcctcct
aacatagtcaatatccatgtgaaacatcctcctgaagcttccgtccagatacatcaggtt
tcaagaattgatggcccaacaggccagaagacaaaagaagctcaaccaggccaatcccaa
gtctcgtaccaagggcttcctgtccagaagacccagaccatacattccacatactcccac
cagcaggtcattcctcacgtctaccccgtggctgctaagacacagcttggccggtgcttc
caggaaaccattgggtcacagtgtggcaaagcgctccctggcctttcaaagcaagaggac
tgctgtggaactgtgggtacctcctggggctttaacaaatgccagaaatgccccaagaaa
ccatcttatcatggatacaaccaaatgatggaatgcctaccgggttataagcgggttaac
aacaccttttgccaagatattaatgaatgtcagctacaaggtgtatgccctaatggtgag
tgtttgaataccatgggcagctatcgatgtacctgcaaaataggatttgggccggatcct
accttttcaagttgtgttcctgatccccctgtgatctcggaagagaaagggccctgttac
cgacttgtcagttctggaagacagtgtatgcaccctctgtctgttcacctcaccaagcag
ctctgctgttgtagtgtgggcaaggcctggggcccacactgtgagaaatgtccccttcca
ggcacagctgcttttaaggaaatctgtcctggtggaatgggttatacggtttctggcgtt
catagacgcaggccaatccatcaccatgtaggtaaaggacctgtatttgtcaagccaaag
aacactcaacctgttgctaaaagtactcatcctccacctctcccagccaaggaagagcca
gtggaggccctgaccttctcccgggaacacgggccaggagtggcggagccagaagtggca
actgcaccccctgaaaaggaaataccttcattggatcaagagaaaaccaaacttgagcct
ggtcaaccccagctgtctccaggcatttccactattcatctgcatccacagtttccagta
gtgattgaaaaaacatcacctcctgtgcctgttgaagtagctcctgaagcttctacgtct
agtgccagccaagtgattgctcctactcaagtgacagaaatcaatgaatgtactgtgaac
cctgatatctgtggagcaggacactgcattaacctaccagtgagatatacctgtatatgc
tacgagggctacaggttcagtgaacaacagaggaaatgtgtggatattgatgagtgtact
caggtccaacacctctgctcccagggccgctgtgaaaacaccgagggaagtttcttgtgc
atttgcccagcaggatttatggccagtgaggagggtactaactgcatagatgttgacgaa
tgcctgaggccggacgtctgtggggaggggcactgtgtcaatactgtgggggccttccgg
tgtgaatactgtgacagcgggtaccgcatgactcagagaggccgttgtgaggatattgat
gaatgtttgaatccaagcacttgtccagatgagcagtgtgtgaattctcctggatcttac
cagtgcgttccctgcacagaaggattccgaggctggaatggacagtgccttgatgtggac
gagtgcctggaaccaaacgtctgcgcaaatggtgattgttccaaccttgaaggctcctac
atgtgttcatgccacaaaggctatacccggactccggaccacaagcactgtagagatatt
gatgaatgtcagcaagggaatctatgtgtaaacgggcagtgcaaaaataccgagggctcc
ttcaggtgcacctgtggacaggggtaccagctgtcggcagctaaagaccagtgtgaagac
attgatgaatgccagcaccgtcatctctgtgctcatgggcagtgcaggaacactgagggc
tcttttcaatgtgtgtgtgaccagggttacagagcatctgggcttggagaccactgtgaa
gatatcaatgaatgcttggaggacaagagtgtttgccagagaggagactgcattaatact
gcagggtcctatgattgtacttgtccggatggatttcagctagatgacaataaaacatgt
caagatattaatgaatgtgaacatccagggctctgtggtccgcaaggggagtgcctaaac
acagagggttctttccattgtgtctgccagcagggtttctcaatctctgcagatggccgt
acgtgtgaagatattgatgaatgtgtaaacaacactgtttgtgacagtcacgggttttgt
gacaatacagctggctccttccgctgcctctgttatcagggctttcaagccccacaggat
gggcaagggtgtgtggatgtgaatgaatgtgaactgctcagtggggtgtgtggtgaagcc
ttctgtgaaaacgtggaagggtccttcctgtgcgtgtgtgctgatgaaaaccaagagtac
agccccatgactgggcagtgccgctcccggacctccacagatttagatgtagatgtagat
caacccaaagaagaaaagaaagaatgctactataatctcaatgacgccagtctctgtgat
aatgtgttggcccccaatgtcacgaaacaagaatgctgctgtacatcaggcgcgggatgg
ggagataactgcgaaatcttcccctgcccggtcttgggaactgctgagttcactgaaatg
tgtcccaaagggaaaggttttgtgcctgctggagaatcatcttctgaagctggtggtgag
aactataaagatgcagatgaatgcctactttttggacaagaaatctgcaaaaatggtttc
tgtttgaacactcggcctgggtatgaatgctactgtaagcaagggacgtactatgatcct
gtgaaactgcagtgctttgatatggatgaatgtcaagaccccagtagttgtattgatggc
cagtgtgttaatacagagggctcttacaactgcttctgtactcaccccatggtcctggat
gcgtcagaaaaaagatgtatacgaccggctgagtcaaacgaacaaatagaagaaactgat
gtctaccaagatttgtgctgggaacatctgagtgatgaatacgtgtgtagccggcctctt
gtgggcaagcagacaacgtacactgagtgctgctgtctgtatggagaggcctggggcatg
cagtgtgccctctgccccctgaaggattcagatgactatgctcagctgtgtaacatcccc
gtgacgggacgccggcagccatatggacgggacgccttggttgacttcagtgaacagtat
actccagaagccgatccctacttcatccaagaccgttttctaaatagctttgaggagtta
caggctgaggaatgcggcatcctcaatggatgtgaaaatggtcgctgtgtgagggtccag
gaaggttacacctgcgattgctttgatgggtatcacttggatacggccaagatgacctgt
gtcgatgtaaatgaatgcgatgagttgaacaaccggatgtctctctgcaagaatgccaag
tgcattaacaccgatggttcctacaagtgtttgtgtctgccaggctacgtgccttctgac
aagccaaactactgcactccgttgaataccgccttgaatttagagaaagacagtgacctg
gagtga

DBGET integrated database retrieval system