KEGG   Homo sapiens (human): 406Help
Entry
406               CDS       T01001                                 

Gene name
ARNTL, BMAL1, BMAL1c, JAP3, MOP3, PASD3, TIC, bHLHe5
Definition
aryl hydrocarbon receptor nuclear translocator-like
Orthology
K02296  
aryl hydrocarbon receptor nuclear translocator-like protein 1
Organism
hsa  Homo sapiens (human)
Pathway
Circadian rhythm
Dopaminergic synapse
Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Nervous system
   04728 Dopaminergic synapse
    406 (ARNTL)
  Environmental adaptation
   04710 Circadian rhythm
    406 (ARNTL)
 Human Diseases
  Infectious diseases
   05168 Herpes simplex infection
    406 (ARNTL)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    406 (ARNTL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
11p15
AA seq 625 aa AA seqDB search
MADQRMDISSTISDFMSPGPTDLLSSSLGTSGVDCNRKRKGSSTDYQESMDTDKDDPHGR
LEYTEHQGRIKNAREAHSQIEKRRRDKMNSFIDELASLVPTCNAMSRKLDKLTVLRMAVQ
HMKTLRGATNPYTEANYKPTFLSDDELKHLILRAADGFLFVVGCDRGKILFVSESVFKIL
NYSQNDLIGQSLFDYLHPKDIAKVKEQLSSSDTAPRERLIDAKTGLPVKTDITPGPSRLC
SGARRSFFCRMKCNRPSVKVEDKDFPSTCSKKKDRKSFCTIHSTGYLKSWPPTKMGLDED
NEPDNEGCNLSCLVAIGRLHSHVVPQPVNGEIRVKSMEYVSRHAIDGKFVFVDQRATAIL
AYLPQELLGTSCYEYFHQDDIGHLAECHRQVLQTREKITTNCYKFKIKDGSFITLRSRWF
SFMNPWTKEVEYIVSTNTVVLANVLEGGDPTFPQLTASPHSMDSMLPSGEGGPKRTHPTV
PGIPGGTRAGAGKIGRMIAEEIMEIHRIRGSSPSSCGSSPLNITSTPPPDASSPGGKKIL
NGGTPDIPSSGLLSGQAQENPGYPYSDSSSILGENPHIGIDMIDNDQGSSSPSNDEAAMA
VIMSLLEADAGLGGPVDFSDLPWPL
NT seq 1878 nt NT seq  +upstreamnt  +downstreamnt
atggcagaccagagaatggacatttcttcaaccatcagtgatttcatgtccccgggcccc
accgacctgctttccagctctcttggtaccagtggtgtggattgcaaccgcaaacggaaa
ggcagctccactgactaccaagaaagcatggacacagacaaagatgaccctcatggaagg
ttagaatatacagaacaccaaggaaggataaaaaatgcaagggaagctcacagtcagatt
gaaaagcggcgtcgggataaaatgaacagttttatagatgaattggcttctttggtacca
acatgcaacgcaatgtccaggaaattagataaacttactgtgctaaggatggctgttcag
cacatgaaaacattaagaggtgccaccaatccatacacagaagcaaactacaaaccaact
tttctatcagacgatgaattgaaacacctcattctcagggcagcagatggatttttgttt
gtcgtaggatgtgaccgagggaagatactctttgtctcagagtctgtcttcaagatcctc
aactacagccagaatgatctgattggtcagagtttgtttgactacctgcatcctaaagat
attgccaaagtcaaggagcagctctcctcctctgacaccgcaccccgggagcggctcata
gatgcaaaaactggacttccagttaaaacagatataacccctgggccatctcgattatgt
tctggagcacgacgttctttcttctgtaggatgaagtgtaacaggccttcagtaaaggtt
gaagacaaggacttcccctctacctgctcaaagaaaaaagatcgaaaaagcttctgcaca
atccacagcacaggctatttgaaaagctggccacccacaaagatggggctggatgaagac
aacgaaccagacaatgaggggtgtaacctcagctgcctcgtcgcaattggacgactgcat
tctcatgtagttccacaaccagtgaacggggaaatcagggtgaaatctatggaatatgtt
tctcggcacgcgatagatggaaagtttgtttttgtagaccagagggcaacagctattttg
gcatatttaccacaagaacttctaggcacatcgtgttatgaatattttcaccaagatgac
ataggacatcttgcagaatgtcataggcaagttttacagacgagagaaaaaattacaact
aattgctataaatttaaaatcaaagatggttcttttatcacactacggagtcgatggttc
agtttcatgaacccttggaccaaggaagtagaatatattgtctcaactaacactgttgtt
ttagccaacgtcctggaaggcggggacccaaccttcccacagctcacagcatccccccac
agcatggacagcatgctgccctctggagaaggtggcccaaagaggacccaccccactgtt
ccagggattccagggggaacccgggctggggcaggaaaaataggccgaatgattgctgag
gaaatcatggaaatccacaggataagagggtcatcgccttctagctgtggctccagccca
ttgaacatcacgagtacgcctccccctgatgcctcttctccaggaggcaagaagatttta
aatggagggactccagacattccttccagtggcctactatcaggccaggctcaggagaac
ccaggttatccatattctgatagttcttctattcttggtgagaacccccacataggtata
gacatgattgacaacgaccaaggatcaagtagtcccagtaatgatgaggcagcaatggct
gtcatcatgagcctcttggaagcagatgctggactgggtggccctgttgactttagtgac
ttgccatggccgctgtaa

DBGET integrated database retrieval system