KEGG   Homo sapiens (human): 4067Help
Entry
4067              CDS       T01001                                 

Gene name
LYN, JTK8, p53Lyn, p56Lyn
Definition
v-yes-1 Yamaguchi sarcoma viral related oncogene homolog (EC:2.7.10.2)
Orthology
K05854  
tyrosine-protein kinase Lyn [EC:2.7.10.2]
Organism
hsa  Homo sapiens (human)
Pathway
Chemokine signaling pathway
NF-kappa B signaling pathway
B cell receptor signaling pathway
Fc epsilon RI signaling pathway
Fc gamma R-mediated phagocytosis
Long-term depression
Epithelial cell signaling in Helicobacter pylori infection
Epstein-Barr virus infection
Viral carcinogenesis
Drug target
Other: 
Class
Environmental Information Processing; Signal transduction; NF-kappa B signaling pathway [PATH:hsa04064]
Organismal Systems; Immune system; B cell receptor signaling pathway [PATH:hsa04662]
Organismal Systems; Immune system; Fc epsilon RI signaling pathway [PATH:hsa04664]
Organismal Systems; Immune system; Fc gamma R-mediated phagocytosis [PATH:hsa04666]
Organismal Systems; Immune system; Chemokine signaling pathway [PATH:hsa04062]
Organismal Systems; Nervous system; Long-term depression [PATH:hsa04730]
Human Diseases; Cancers; Viral carcinogenesis [PATH:hsa05203]
Human Diseases; Infectious diseases; Epithelial cell signaling in Helicobacter pylori infection [PATH:hsa05120]
Human Diseases; Infectious diseases; Epstein-Barr virus infection [PATH:hsa05169]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
8q13
AA seq 491 aa AA seqDB search
MGCIKSKGKDSLSDDGVDLKTQPVPESQLLPGQRFQTKDPEEQGDIVVALYPYDGIHPDD
LSFKKGEKMKVLEEHGEWWKAKSLLTKKEGFIPSNYVAKLNTLETEEWFFKDITRKDAER
QLLAPGNSAGAFLIRESETLKGSFSLSVRDFDPVHGDVIKHYKIRSLDNGGYYISPRITF
PCISDMIKHYQKQADGLCRRLEKACISPKPQKPWDKDAWEIPRESIKLVKRLGAGQFGEV
WMGYYNNSTKVAVKTLKPGTMSVQAFLEEANLMKTLQHDKLVRLYAVVTREEPIYIITEY
MAKGSLLDFLKSDEGGKVLLPKLIDFSAQIAEGMAYIERKNYIHRDLRAANVLVSESLMC
KIADFGLARVIEDNEYTAREGAKFPIKWTAPEAINFGCFTIKSDVWSFGILLYEIVTYGK
IPYPGRTNADVMTALSQGYRMPRVENCPDELYDIMKMCWKEKAEERPTFDYLQSVLDDFY
TATEGQYQQQP
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgggatgtataaaatcaaaagggaaagacagcttgagtgacgatggagtagatttgaag
actcaaccagttccagaatctcagcttttacctggacagaggtttcaaactaaagatcca
gaggaacaaggagacattgtggtagccttgtacccctatgatggcatccacccggacgac
ttgtctttcaagaaaggagagaagatgaaagtcctggaggagcatggagaatggtggaaa
gcaaagtcccttttaacaaaaaaagaaggcttcatccccagcaactatgtggccaaactc
aacaccttagaaacagaagagtggtttttcaaggatataaccaggaaggacgcagaaagg
cagcttttggcaccaggaaatagcgctggagctttccttattagagaaagtgaaacatta
aaaggaagcttctctctgtctgtcagagactttgaccctgtgcatggtgatgttattaag
cactacaaaattagaagtctggataatgggggctattacatctctccacgaatcactttt
ccctgtatcagcgacatgattaaacattaccaaaagcaggcagatggcttgtgcagaaga
ttggagaaggcttgtattagtcccaagccacagaagccatgggataaagatgcctgggag
atcccccgggagtccatcaagttggtgaaaaggcttggcgctgggcagtttggggaagtc
tggatgggttactataacaacagtaccaaggtggctgtgaaaaccctgaagccaggaact
atgtctgtgcaagccttcctggaagaagccaacctcatgaagaccctgcagcatgacaag
ctcgtgaggctctacgctgtggtcaccagggaggagcccatttacatcatcaccgagtac
atggccaagggcagtttgctggatttcctgaagagcgatgaaggtggcaaagtgctgctt
ccaaagctcattgacttttctgctcagattgcagagggaatggcatacatcgagcggaag
aactacattcaccgggacctgcgagcagctaatgttctggtctccgagtcactcatgtgc
aaaattgcagattttggccttgctagagtaattgaagataatgagtacacagcaagggaa
ggtgctaagttccctattaagtggacggctccagaagcaatcaactttggatgtttcact
attaagtctgatgtgtggtcctttggaatcctcctatacgaaattgtcacctatgggaaa
attccctacccagggagaactaatgccgacgtgatgaccgccctgtcccagggctacagg
atgccccgtgtggagaactgcccagatgagctctatgacattatgaaaatgtgctggaaa
gaaaaggcagaagagagaccaacgtttgactacttacagagcgtcctggatgatttctac
acagccacggaagggcaataccagcagcagccttag

DBGET integrated database retrieval system