KEGG   Homo sapiens (human): 4067Help
Entry
4067              CDS       T01001                                 

Gene name
LYN, JTK8, p53Lyn, p56Lyn
Definition
LYN proto-oncogene, Src family tyrosine kinase (EC:2.7.10.2)
Orthology
K05854  
tyrosine-protein kinase Lyn [EC:2.7.10.2]
Organism
hsa  Homo sapiens (human)
Pathway
Chemokine signaling pathway
NF-kappa B signaling pathway
Platelet activation
B cell receptor signaling pathway
Fc epsilon RI signaling pathway
Fc gamma R-mediated phagocytosis
Long-term depression
Epithelial cell signaling in Helicobacter pylori infection
Epstein-Barr virus infection
Viral carcinogenesis
Drug target
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04064 NF-kappa B signaling pathway
    4067 (LYN)
 Organismal Systems
  Immune system
   04611 Platelet activation
    4067 (LYN)
   04662 B cell receptor signaling pathway
    4067 (LYN)
   04664 Fc epsilon RI signaling pathway
    4067 (LYN)
   04666 Fc gamma R-mediated phagocytosis
    4067 (LYN)
   04062 Chemokine signaling pathway
    4067 (LYN)
  Nervous system
   04730 Long-term depression
    4067 (LYN)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    4067 (LYN)
  Infectious diseases
   05120 Epithelial cell signaling in Helicobacter pylori infection
    4067 (LYN)
   05169 Epstein-Barr virus infection
    4067 (LYN)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     4067 (LYN)
Protein kinases [BR:hsa01001]
 Tyrosine protein kinases
  Src family
   4067 (LYN)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
8q13
AA seq 491 aa AA seqDB search
MGCIKSKGKDSLSDDGVDLKTQPVPESQLLPGQRFQTKDPEEQGDIVVALYPYDGIHPDD
LSFKKGEKMKVLEEHGEWWKAKSLLTKKEGFIPSNYVAKLNTLETEEWFFKDITRKDAER
QLLAPGNSAGAFLIRESETLKGSFSLSVRDFDPVHGDVIKHYKIRSLDNGGYYISPRITF
PCISDMIKHYQKQADGLCRRLEKACISPKPQKPWDKDAWEIPRESIKLVKRLGAGQFGEV
WMGYYNNSTKVAVKTLKPGTMSVQAFLEEANLMKTLQHDKLVRLYAVVTREEPIYIITEY
MAKGSLLDFLKSDEGGKVLLPKLIDFSAQIAEGMAYIERKNYIHRDLRAANVLVSESLMC
KIADFGLARVIEDNEYTAREGAKFPIKWTAPEAINFGCFTIKSDVWSFGILLYEIVTYGK
IPYPGRTNADVMTALSQGYRMPRVENCPDELYDIMKMCWKEKAEERPTFDYLQSVLDDFY
TATEGQYQQQP
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgggatgtataaaatcaaaagggaaagacagcttgagtgacgatggagtagatttgaag
actcaaccagttccagaatctcagcttttacctggacagaggtttcaaactaaagatcca
gaggaacaaggagacattgtggtagccttgtacccctatgatggcatccacccggacgac
ttgtctttcaagaaaggagagaagatgaaagtcctggaggagcatggagaatggtggaaa
gcaaagtcccttttaacaaaaaaagaaggcttcatccccagcaactatgtggccaaactc
aacaccttagaaacagaagagtggtttttcaaggatataaccaggaaggacgcagaaagg
cagcttttggcaccaggaaatagcgctggagctttccttattagagaaagtgaaacatta
aaaggaagcttctctctgtctgtcagagactttgaccctgtgcatggtgatgttattaag
cactacaaaattagaagtctggataatgggggctattacatctctccacgaatcactttt
ccctgtatcagcgacatgattaaacattaccaaaagcaggcagatggcttgtgcagaaga
ttggagaaggcttgtattagtcccaagccacagaagccatgggataaagatgcctgggag
atcccccgggagtccatcaagttggtgaaaaggcttggcgctgggcagtttggggaagtc
tggatgggttactataacaacagtaccaaggtggctgtgaaaaccctgaagccaggaact
atgtctgtgcaagccttcctggaagaagccaacctcatgaagaccctgcagcatgacaag
ctcgtgaggctctacgctgtggtcaccagggaggagcccatttacatcatcaccgagtac
atggccaagggcagtttgctggatttcctgaagagcgatgaaggtggcaaagtgctgctt
ccaaagctcattgacttttctgctcagattgcagagggaatggcatacatcgagcggaag
aactacattcaccgggacctgcgagcagctaatgttctggtctccgagtcactcatgtgc
aaaattgcagattttggccttgctagagtaattgaagataatgagtacacagcaagggaa
ggtgctaagttccctattaagtggacggctccagaagcaatcaactttggatgtttcact
attaagtctgatgtgtggtcctttggaatcctcctatacgaaattgtcacctatgggaaa
attccctacccagggagaactaatgccgacgtgatgaccgccctgtcccagggctacagg
atgccccgtgtggagaactgcccagatgagctctatgacattatgaaaatgtgctggaaa
gaaaaggcagaagagagaccaacgtttgactacttacagagcgtcctggatgatttctac
acagccacggaagggcaataccagcagcagccttag

DBGET integrated database retrieval system