KEGG   Homo sapiens (human): 4069Help
Entry
4069              CDS       T01001                                 

Gene name
LYZ, LZM
Definition
lysozyme (EC:3.2.1.17)
Orthology
K13915  
lysozyme C [EC:3.2.1.17]
Organism
hsa  Homo sapiens (human)
Pathway
Salivary secretion
Disease
H00845  
Familial amyloidosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Digestive system
   04970 Salivary secretion
    4069 (LYZ)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     4069 (LYZ)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   4069 (LYZ)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 
1JSF 1IWT 1IWU 1IWV 1IWW 1IWX 1IWY 1JWR 1IWZ 3FE0 1REX 1LZR 1LZ1 1JKC 1LMT 1LZS 1JKA 1JKB 1GE1 1REY 1REZ 1TAY 1TCY 1TDY 133L 134L 1TBY 1LAA 2ZWB 2ZIL 1IX0 1IP1 1IP2 1IP3 1IP4 1IP5 1IP6 1I1Z 1I22 1GF8 1GF9 1GFA 1GFE 1GFG 1GFH 1GFJ 1GFK 1GFR 1GFT 1GFU 1GFV 1INU 1GEZ 1GF0 1GF3 1GF4 1GF5 1GF6 1GF7 1GDW 1GDX 1GE0 1GE3 1GE4 1GAY 1GAZ 1GB0 1GB2 1GB3 1GB5 1GB6 1GB7 1GB8 1GB9 1GBO 1GBW 1GBX 1GBY 1GBZ 1EQE 1EQ4 1EQ5 1DI3 1C43 1C45 1CJ6 1CJ7 1CJ8 1CJ9 1CKC 1CKD 1CKF 1B7O 1B7R 1B7L 1B7N 1B5U 2BQA 2BQB 2BQC 2BQD 2BQE 2BQF 2BQG 2BQH 2BQI 2BQJ 2BQK 2BQL 2BQM 2BQN 2BQO 2MEF 2MEB 2MED 2MEE 2MEG 2MEH 2MEI 1BB3 1BB5 1WQM 1WQN 1WQO 1WQP 1WQQ 1WQR 2HEA 2HEC 2HED 2HEE 2HEF 1LOZ 1LYY 1JKD 1OUA 1OUB 1OUC 1OUD 1OUE 1OUF 1OUG 1OUH 1OUI 1OUJ 207L 1YAM 1YAN 1YAO 1YAP 1YAQ 1HNL 1LZ4 1LZ5 1LZ6 1LHH 1LHI 1LHJ 1LHK 1LHL 1LHM 2LHM 3LHM 2ZIK 3EBA 1QSW 1OP9 2ZIJ 1IP7 1I20 4I0C 1D6Q 1UBZ 1GE2 1DI4 1CKH 1B7Q 1B7S 1B5X 1B7P 3LN2 1GEV 1REM 1B5V 1B5W 1DI5 1C46 1CKG 1B7M 1B5Y 1B5Z 2MEA 2MEC 2HEB 208L 1D6P 1BB4 1RE2 1IOC 1C7P 1W08 1IY3 1IY4
Thumbnails

Jmol
Position
12q15
AA seq 148 aa AA seqDB search
MKALIVLGLVLLSVTVQGKVFERCELARTLKRLGMDGYRGISLANWMCLAKWESGYNTRA
TNYNAGDRSTDYGIFQINSRYWCNDGKTPGAVNACHLSCSALLQDNIADAVACAKRVVRD
PQGIRAWVAWRNRCQNRDVRQYVQGCGV
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atgaaggctctcattgttctggggcttgtcctcctttctgttacggtccagggcaaggtc
tttgaaaggtgtgagttggccagaactctgaaaagattgggaatggatggctacagggga
atcagcctagcaaactggatgtgtttggccaaatgggagagtggttacaacacacgagct
acaaactacaatgctggagacagaagcactgattatgggatatttcagatcaatagccgc
tactggtgtaatgatggcaaaaccccaggagcagttaatgcctgtcatttatcctgcagt
gctttgctgcaagataacatcgctgatgctgtagcttgtgcaaagagggttgtccgtgat
ccacaaggcattagagcatgggtggcatggagaaatcgttgtcaaaacagagatgtccgt
cagtatgttcaaggttgtggagtgtaa

DBGET integrated database retrieval system