KEGG   Homo sapiens (human): 408Help
Entry
408               CDS       T01001                                 

Gene name
ARRB1, ARB1, ARR1
Definition
arrestin, beta 1
Orthology
K04439  
beta-arrestin
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Chemokine signaling pathway
Endocytosis
Phototransduction
Morphine addiction
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:hsa04010]
Cellular Processes; Transport and catabolism; Endocytosis [PATH:hsa04144]
Organismal Systems; Immune system; Chemokine signaling pathway [PATH:hsa04062]
Organismal Systems; Sensory system; Phototransduction [PATH:hsa04744]
Human Diseases; Substance dependence; Morphine addiction [PATH:hsa05032]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
11q13
AA seq 418 aa AA seqDB search
MGDKGTRVFKKASPNGKLTVYLGKRDFVDHIDLVDPVDGVVLVDPEYLKERRVYVTLTCA
FRYGREDLDVLGLTFRKDLFVANVQSFPPAPEDKKPLTRLQERLIKKLGEHAYPFTFEIP
PNLPCSVTLQPGPEDTGKACGVDYEVKAFCAENLEEKIHKRNSVRLVIRKVQYAPERPGP
QPTAETTRQFLMSDKPLHLEASLDKEIYYHGEPISVNVHVTNNTNKTVKKIKISVRQYAD
ICLFNTAQYKCPVAMEEADDTVAPSSTFCKVYTLTPFLANNREKRGLALDGKLKHEDTNL
ASSTLLREGANREILGIIVSYKVKVKLVVSRGGLLGDLASSDVAVELPFTLMHPKPKEEP
PHREVPENETPVDTNLIELDTNDDDIVFEDFARQRLKGMKDDKEEEEDGTGSPQLNNR
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgggcgacaaagggacccgagtgttcaagaaggccagtccaaatggaaagctcaccgtc
tacctgggaaagcgggactttgtggaccacatcgacctcgtggaccctgtggatggtgtg
gtcctggtggatcctgagtatctcaaagagcggagagtctatgtgacgctgacctgcgcc
ttccgctatggccgggaggacctggatgtcctgggcctgacctttcgcaaggacctgttt
gtggccaacgtacagtcgttcccaccggcccccgaggacaagaagcccctgacgcggctg
caggaacgcctcatcaagaagctgggcgagcacgcttaccctttcacctttgagatccct
ccaaaccttccatgttctgtgacactgcagccggggcccgaagacacggggaaggcttgc
ggtgtggactatgaagtcaaagccttctgcgcggagaatttggaggagaagatccacaag
cggaattctgtgcgtctggtcatccggaaggttcagtatgccccagagaggcctggcccc
cagcccacagccgagaccaccaggcagttcctcatgtcggacaagcccttgcacctagaa
gcctctctggataaggagatctattaccatggagaacccatcagcgtcaacgtccacgtc
accaacaacaccaacaagacggtgaagaagatcaagatctcagtgcgccagtatgcagac
atctgccttttcaacacagctcagtacaagtgccctgttgccatggaagaggctgatgac
actgtggcacccagctcgacgttctgcaaggtctacacactgacccccttcctagccaat
aaccgagagaagcggggcctcgccttggacgggaagctcaagcacgaagacacgaacttg
gcctctagcaccctgttgagggaaggtgccaaccgtgagatcctggggatcattgtttcc
tacaaagtgaaagtgaagctggtggtgtctcggggcggcctgttgggagatcttgcatcc
agcgacgtggccgtggaactgcccttcaccctaatgcaccccaagcccaaagaggaaccc
ccgcatcgggaagttccagagaacgagacgccagtagataccaatctcatagaacttgac
acaaatgatgacgacattgtatttgaggactttgctcgccagagactgaaaggcatgaag
gatgacaaggaggaagaggaggatggtaccggctctccacagctcaacaacagatag

DBGET integrated database retrieval system