KEGG   Homo sapiens (human): 408Help
Entry
408               CDS       T01001                                 

Gene name
ARRB1, ARB1, ARR1
Definition
arrestin, beta 1
Orthology
K04439  
beta-arrestin
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Chemokine signaling pathway
Endocytosis
Phototransduction
Morphine addiction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    408 (ARRB1)
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    408 (ARRB1)
 Organismal Systems
  Immune system
   04062 Chemokine signaling pathway
    408 (ARRB1)
  Sensory system
   04744 Phototransduction
    408 (ARRB1)
 Human Diseases
  Substance dependence
   05032 Morphine addiction
    408 (ARRB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
11q13
AA seq 418 aa AA seqDB search
MGDKGTRVFKKASPNGKLTVYLGKRDFVDHIDLVDPVDGVVLVDPEYLKERRVYVTLTCA
FRYGREDLDVLGLTFRKDLFVANVQSFPPAPEDKKPLTRLQERLIKKLGEHAYPFTFEIP
PNLPCSVTLQPGPEDTGKACGVDYEVKAFCAENLEEKIHKRNSVRLVIRKVQYAPERPGP
QPTAETTRQFLMSDKPLHLEASLDKEIYYHGEPISVNVHVTNNTNKTVKKIKISVRQYAD
ICLFNTAQYKCPVAMEEADDTVAPSSTFCKVYTLTPFLANNREKRGLALDGKLKHEDTNL
ASSTLLREGANREILGIIVSYKVKVKLVVSRGGLLGDLASSDVAVELPFTLMHPKPKEEP
PHREVPENETPVDTNLIELDTNDDDIVFEDFARQRLKGMKDDKEEEEDGTGSPQLNNR
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgggcgacaaagggacccgagtgttcaagaaggccagtccaaatggaaagctcaccgtc
tacctgggaaagcgggactttgtggaccacatcgacctcgtggaccctgtggatggtgtg
gtcctggtggatcctgagtatctcaaagagcggagagtctatgtgacgctgacctgcgcc
ttccgctatggccgggaggacctggatgtcctgggcctgacctttcgcaaggacctgttt
gtggccaacgtacagtcgttcccaccggcccccgaggacaagaagcccctgacgcggctg
caggaacgcctcatcaagaagctgggcgagcacgcttaccctttcacctttgagatccct
ccaaaccttccatgttctgtgacactgcagccggggcccgaagacacggggaaggcttgc
ggtgtggactatgaagtcaaagccttctgcgcggagaatttggaggagaagatccacaag
cggaattctgtgcgtctggtcatccggaaggttcagtatgccccagagaggcctggcccc
cagcccacagccgagaccaccaggcagttcctcatgtcggacaagcccttgcacctagaa
gcctctctggataaggagatctattaccatggagaacccatcagcgtcaacgtccacgtc
accaacaacaccaacaagacggtgaagaagatcaagatctcagtgcgccagtatgcagac
atctgccttttcaacacagctcagtacaagtgccctgttgccatggaagaggctgatgac
actgtggcacccagctcgacgttctgcaaggtctacacactgacccccttcctagccaat
aaccgagagaagcggggcctcgccttggacgggaagctcaagcacgaagacacgaacttg
gcctctagcaccctgttgagggaaggtgccaaccgtgagatcctggggatcattgtttcc
tacaaagtgaaagtgaagctggtggtgtctcggggcggcctgttgggagatcttgcatcc
agcgacgtggccgtggaactgcccttcaccctaatgcaccccaagcccaaagaggaaccc
ccgcatcgggaagttccagagaacgagacgccagtagataccaatctcatagaacttgac
acaaatgatgacgacattgtatttgaggactttgctcgccagagactgaaaggcatgaag
gatgacaaggaggaagaggaggatggtaccggctctccacagctcaacaacagatag

DBGET integrated database retrieval system