KEGG   Homo sapiens (human): 4085Help
Entry
4085              CDS       T01001                                 

Gene name
MAD2L1, HSMAD2, MAD2
Definition
MAD2 mitotic arrest deficient-like 1 (yeast)
Orthology
K02537  
mitotic spindle assembly checkpoint protein MAD2
Organism
hsa  Homo sapiens (human)
Pathway
Cell cycle
Oocyte meiosis
Progesterone-mediated oocyte maturation
HTLV-I infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    4085 (MAD2L1)
   04114 Oocyte meiosis
    4085 (MAD2L1)
 Organismal Systems
  Endocrine system
   04914 Progesterone-mediated oocyte maturation
    4085 (MAD2L1)
 Human Diseases
  Infectious diseases
   05166 HTLV-I infection
    4085 (MAD2L1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Structure
PDB: 

Jmol
Position
4q27
AA seq 205 aa AA seqDB search
MALQLSREQGITLRGSAEIVAEFFSFGINSILYQRGIYPSETFTRVQKYGLTLLVTTDLE
LIKYLNNVVEQLKDWLYKCSVQKLVVVISNIESGEVLERWQFDIECDKTAKDDSAPREKS
QKAIQDEIRSVIRQITATVTFLPLLEVSCSFDLLIYTDKDLVVPEKWEESGPQFITNSEE
VRLRSFTTTIHKVNSMVAYKIPVND
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atggcgctgcagctctcccgggagcagggaatcaccctgcgcgggagcgccgaaatcgtg
gccgagttcttctcattcggcatcaacagcattttatatcagcgtggcatatatccatct
gaaacctttactcgagtgcagaaatacggactcaccttgcttgtaactactgatcttgag
ctcataaaatacctaaataatgtggtggaacaactgaaagattggttatacaagtgttca
gttcagaaactggttgtagttatctcaaatattgaaagtggtgaggtcctggaaagatgg
cagtttgatattgagtgtgacaagactgcaaaagatgacagtgcacccagagaaaagtct
cagaaagctatccaggatgaaatccgttcagtgatcagacagatcacagctacggtgaca
tttctgccactgttggaagtttcttgttcatttgatctgctgatttatacagacaaagat
ttggttgtacctgaaaaatgggaagagtcgggaccacagtttattaccaattctgaggaa
gtccgccttcgttcatttactactacaatccacaaagtaaatagcatggtggcctacaaa
attcctgtcaatgactga

DBGET integrated database retrieval system