KEGG   Homo sapiens (human): 4087Help
Entry
4087              CDS       T01001                                 

Gene name
SMAD2, JV18, JV18-1, MADH2, MADR2, hMAD-2, hSMAD2
Definition
SMAD family member 2
Orthology
K04500  
mothers against decapentaplegic homolog 2/3
Organism
hsa  Homo sapiens (human)
Pathway
FoxO signaling pathway
Cell cycle
Endocytosis
TGF-beta signaling pathway
Hippo signaling pathway
Adherens junction
Signaling pathways regulating pluripotency of stem cells
Chagas disease (American trypanosomiasis)
HTLV-I infection
Pathways in cancer
Proteoglycans in cancer
Colorectal cancer
Pancreatic cancer
Inflammatory bowel disease (IBD)
Module
TGF-beta signaling
Activin signaling
Disease
H00020  
Colorectal cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04350 TGF-beta signaling pathway
    4087 (SMAD2)
   04390 Hippo signaling pathway
    4087 (SMAD2)
   04068 FoxO signaling pathway
    4087 (SMAD2)
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    4087 (SMAD2)
  Cell growth and death
   04110 Cell cycle
    4087 (SMAD2)
  Cellular commiunity
   04520 Adherens junction
    4087 (SMAD2)
   04550 Signaling pathways regulating pluripotency of stem cells
    4087 (SMAD2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    4087 (SMAD2)
   05205 Proteoglycans in cancer
    4087 (SMAD2)
   05210 Colorectal cancer
    4087 (SMAD2)
   05212 Pancreatic cancer
    4087 (SMAD2)
  Immune diseases
   05321 Inflammatiory bowel disease (IBD)
    4087 (SMAD2)
  Infectious diseases
   05166 HTLV-I infection
    4087 (SMAD2)
   05142 Chagas disease (American trypanosomiasis)
    4087 (SMAD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
18q21.1
AA seq 467 aa AA seqDB search
MSSILPFTPPVVKRLLGWKKSAGGSGGAGGGEQNGQEEKWCEKAVKSLVKKLKKTGRLDE
LEKAITTQNCNTKCVTIPSTCSEIWGLSTPNTIDQWDTTGLYSFSEQTRSLDGRLQVSHR
KGLPHVIYCRLWRWPDLHSHHELKAIENCEYAFNLKKDEVCVNPYHYQRVETPVLPPVLV
PRHTEILTELPPLDDYTHSIPENTNFPAGIEPQSNYIPETPPPGYISEDGETSDQQLNQS
MDTGSPAELSPTTLSPVNHSLDLQPVTYSEPAFWCSIAYYELNQRVGETFHASQPSLTVD
GFTDPSNSERFCLGLLSNVNRNATVEMTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSP
NCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGFEAVYQLTRMCTIRMSFVK
GWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSVRCSSMS
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtccatcttgccattcacgccgccagttgtgaagagactgctgggatggaagaag
tcagctggtgggtctggaggagcaggcggaggagagcagaatgggcaggaagaaaagtgg
tgtgagaaagcagtgaaaagtctggtgaagaagctaaagaaaacaggacgattagatgag
cttgagaaagccatcaccactcaaaactgtaatactaaatgtgttaccataccaagcact
tgctctgaaatttggggactgagtacaccaaatacgatagatcagtgggatacaacaggc
ctttacagcttctctgaacaaaccaggtctcttgatggtcgtctccaggtatcccatcga
aaaggattgccacatgttatatattgccgattatggcgctggcctgatcttcacagtcat
catgaactcaaggcaattgaaaactgcgaatatgcttttaatcttaaaaaggatgaagta
tgtgtaaacccttaccactatcagagagttgagacaccagttttgcctccagtattagtg
ccccgacacaccgagatcctaacagaacttccgcctctggatgactatactcactccatt
ccagaaaacactaacttcccagcaggaattgagccacagagtaattatattccagaaacg
ccacctcctggatatatcagtgaagatggagaaacaagtgaccaacagttgaatcaaagt
atggacacaggctctccagcagaactatctcctactactctttcccctgttaatcatagc
ttggatttacagccagttacttactcagaacctgcattttggtgttcgatagcatattat
gaattaaatcagagggttggagaaaccttccatgcatcacagccctcactcactgtagat
ggctttacagacccatcaaattcagagaggttctgcttaggtttactctccaatgttaac
cgaaatgccacggtagaaatgacaagaaggcatataggaagaggagtgcgcttatactac
ataggtggggaagtttttgctgagtgcctaagtgatagtgcaatctttgtgcagagcccc
aattgtaatcagagatatggctggcaccctgcaacagtgtgtaaaattccaccaggctgt
aatctgaagatcttcaacaaccaggaatttgctgctcttctggctcagtctgttaatcag
ggttttgaagccgtctatcagctaactagaatgtgcaccataagaatgagttttgtgaaa
gggtggggagcagaataccgaaggcagacggtaacaagtactccttgctggattgaactt
catctgaatggacctctacagtggttggacaaagtattaactcagatgggatccccttca
gtgcgttgctcaagcatgtcataa

DBGET integrated database retrieval system