KEGG   Homo sapiens (human): 4089Help
Entry
4089              CDS       T01001                                 

Gene name
SMAD4, DPC4, JIP, MADH4, MYHRS
Definition
(RefSeq) SMAD family member 4
  KO
K04501  mothers against decapentaplegic homolog 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04068  FoxO signaling pathway
hsa04110  Cell cycle
hsa04310  Wnt signaling pathway
hsa04350  TGF-beta signaling pathway
hsa04371  Apelin signaling pathway
hsa04390  Hippo signaling pathway
hsa04520  Adherens junction
hsa04550  Signaling pathways regulating pluripotency of stem cells
hsa04659  Th17 cell differentiation
hsa04933  AGE-RAGE signaling pathway in diabetic complications
hsa05161  Hepatitis B
hsa05166  HTLV-I infection
hsa05200  Pathways in cancer
hsa05210  Colorectal cancer
hsa05212  Pancreatic cancer
hsa05220  Chronic myeloid leukemia
hsa05225  Hepatocellular carcinoma
hsa05226  Gastric cancer
Module
hsa_M00679  BMP signaling
hsa_M00680  TGF-beta signaling
hsa_M00681  Activin signaling
Network
N00063  TGF-beta signaling pathway
N00106  AML1-EVI1 fusion to TGF-beta signaling pathway
N00107  EVI-1 overexpression to TGF-beta signaling pathway
Disease
H00019  Pancreatic cancer
H00020  Colorectal cancer
H00533  Hereditary hemorrhagic telangiectasia (HHT)
H01023  Juvenile polyposis syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    4089 (SMAD4)
   04350 TGF-beta signaling pathway
    4089 (SMAD4)
   04390 Hippo signaling pathway
    4089 (SMAD4)
   04371 Apelin signaling pathway
    4089 (SMAD4)
   04068 FoxO signaling pathway
    4089 (SMAD4)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    4089 (SMAD4)
  Cellular community - eukaryotes
   04520 Adherens junction
    4089 (SMAD4)
   04550 Signaling pathways regulating pluripotency of stem cells
    4089 (SMAD4)
 Organismal Systems
  Immune system
   04659 Th17 cell differentiation
    4089 (SMAD4)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    4089 (SMAD4)
   05210 Colorectal cancer
    4089 (SMAD4)
   05212 Pancreatic cancer
    4089 (SMAD4)
   05225 Hepatocellular carcinoma
    4089 (SMAD4)
   05226 Gastric cancer
    4089 (SMAD4)
   05220 Chronic myeloid leukemia
    4089 (SMAD4)
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    4089 (SMAD4)
  Infectious diseases
   05166 HTLV-I infection
    4089 (SMAD4)
   05161 Hepatitis B
    4089 (SMAD4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MH2 MH1 IRF-3
Motif
Other DBs
NCBI-GeneID: 4089
NCBI-ProteinID: NP_005350
OMIM: 600993
HGNC: 6770
Ensembl: ENSG00000141646
Vega: OTTHUMG00000132696
Pharos: Q13485(Tbio)
UniProt: Q13485 A0A024R274
Structure
PDB: 

Jmol
Position
18q21.2
AA seq 552 aa AA seqDB search
MDNMSITNTPTSNDACLSIVHSLMCHRQGGESETFAKRAIESLVKKLKEKKDELDSLITA
ITTNGAHPSKCVTIQRTLDGRLQVAGRKGFPHVIYARLWRWPDLHKNELKHVKYCQYAFD
LKCDSVCVNPYHYERVVSPGIDLSGLTLQSNAPSSMMVKDEYVHDFEGQPSLSTEGHSIQ
TIQHPPSNRASTETYSTPALLAPSESNATSTANFPNIPVASTSQPASILGGSHSEGLLQI
ASGPQPGQQQNGFTGQPATYHHNSTTTWTGSRTAPYTPNLPHHQNGHLQHHPPMPPHPGH
YWPVHNELAFQPPISNHPAPEYWCSIAYFEMDVQVGETFKVPSSCPIVTVDGYVDPSGGD
RFCLGQLSNVHRTEAIERARLHIGKGVQLECKGEGDVWVRCLSDHAVFVQSYYLDREAGR
APGDAVHKIYPSAYIKVFDLRQCHRQMQQQAATAQAAAAAQAAAVAGNIPGPGSVGGIAP
AISLSAAAGIGVDDLRRLCILRMSFVKGWGPDYPRQSIKETPCWIEIHLHRALQLLDEVL
HTMPIADPQPLD
NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt
atggacaatatgtctattacgaatacaccaacaagtaatgatgcctgtctgagcattgtg
catagtttgatgtgccatagacaaggtggagagagtgaaacatttgcaaaaagagcaatt
gaaagtttggtaaagaagctgaaggagaaaaaagatgaattggattctttaataacagct
ataactacaaatggagctcatcctagtaaatgtgttaccatacagagaacattggatggg
aggcttcaggtggctggtcggaaaggatttcctcatgtgatctatgcccgtctctggagg
tggcctgatcttcacaaaaatgaactaaaacatgttaaatattgtcagtatgcgtttgac
ttaaaatgtgatagtgtctgtgtgaatccatatcactacgaacgagttgtatcacctgga
attgatctctcaggattaacactgcagagtaatgctccatcaagtatgatggtgaaggat
gaatatgtgcatgactttgagggacagccatcgttgtccactgaaggacattcaattcaa
accatccagcatccaccaagtaatcgtgcatcgacagagacatacagcaccccagctctg
ttagccccatctgagtctaatgctaccagcactgccaactttcccaacattcctgtggct
tccacaagtcagcctgccagtatactggggggcagccatagtgaaggactgttgcagata
gcatcagggcctcagccaggacagcagcagaatggatttactggtcagccagctacttac
catcataacagcactaccacctggactggaagtaggactgcaccatacacacctaatttg
cctcaccaccaaaacggccatcttcagcaccacccgcctatgccgccccatcccggacat
tactggcctgttcacaatgagcttgcattccagcctcccatttccaatcatcctgctcct
gagtattggtgttccattgcttactttgaaatggatgttcaggtaggagagacatttaag
gttccttcaagctgccctattgttactgttgatggatacgtggacccttctggaggagat
cgcttttgtttgggtcaactctccaatgtccacaggacagaagccattgagagagcaagg
ttgcacataggcaaaggtgtgcagttggaatgtaaaggtgaaggtgatgtttgggtcagg
tgccttagtgaccacgcggtctttgtacagagttactacttagacagagaagctgggcgt
gcacctggagatgctgttcataagatctacccaagtgcatatataaaggtctttgatttg
cgtcagtgtcatcgacagatgcagcagcaggcggctactgcacaagctgcagcagctgcc
caggcagcagccgtggcaggaaacatccctggcccaggatcagtaggtggaatagctcca
gctatcagtctgtcagctgctgctggaattggtgttgatgaccttcgtcgcttatgcata
ctcaggatgagttttgtgaaaggctggggaccggattacccaagacagagcatcaaagaa
acaccttgctggattgaaattcacttacaccgggccctccagctcctagacgaagtactt
cataccatgccgattgcagacccacaacctttagactga

DBGET integrated database retrieval system