KEGG   Homo sapiens (human): 4091Help
Entry
4091              CDS       T01001                                 

Gene name
SMAD6, AOVD2, HsT17432, MADH6, MADH7
Definition
SMAD family member 6
Orthology
K04677  
mothers against decapentaplegic homolog 6/7
Organism
hsa  Homo sapiens (human)
Pathway
Endocytosis
TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04350 TGF-beta signaling pathway
    4091 (SMAD6)
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    4091 (SMAD6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
15q21-q22
AA seq 235 aa AA seqDB search
MSRMGKPIETQKSPPPPYSRLSPRDEYKPLDLSDSTLSYTETEATNSLITAPGEFSDASM
SPDATKPSHWCSVAYWEHRTRVGRLYAVYDQAVSIFYDLPQGSGFCLGQLNLEQRSESVR
RTRSKIGFGILLSKEPDGVWAYNRGEHPIFVNSPTLDAPGGRALVVRKVPPGYSIKVFDF
ERSGLQHAPEPDAADGPYDPNSVRISFAKGWGPCYSRQFITSCPCWLEILLNNPR
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgtccagaatgggcaaacccatagagacacaaaaatctccgccacctccctactctcgg
ctgtctcctcgcgacgagtacaagccactggatctgtccgattccacattgtcttacact
gaaacggaggctaccaactccctcatcactgctccgggtgaattctcagacgccagcatg
tctccggacgccaccaagccgagccactggtgcagcgtggcgtactgggagcaccggacg
cgcgtgggccgcctctatgcggtgtacgaccaggccgtcagcatcttctacgacctacct
cagggcagcggcttctgcctgggccagctcaacctggagcagcgcagcgagtcggtgcgg
cgaacgcgcagcaagatcggcttcggcatcctgctcagcaaggagcccgacggcgtgtgg
gcctacaaccgcggcgagcaccccatcttcgtcaactccccgacgctggacgcgcccggc
ggccgcgccctggtcgtgcgcaaggtgccccccggctactccatcaaggtgttcgacttc
gagcgctcgggcctgcagcacgcgcccgagcccgacgccgccgacggcccctacgacccc
aacagcgtccgcatcagcttcgccaagggctgggggccctgctactcccggcagttcatc
acctcctgcccctgctggctggagatcctcctcaacaaccccagatag

DBGET integrated database retrieval system