KEGG   Homo sapiens (human): 4092Help
Entry
4092              CDS       T01001                                 

Gene name
SMAD7, CRCS3, MADH7, MADH8
Definition
SMAD family member 7
Orthology
K04677  
mothers against decapentaplegic homolog 6/7
Organism
hsa  Homo sapiens (human)
Pathway
Endocytosis
TGF-beta signaling pathway
Hippo signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04350 TGF-beta signaling pathway
    4092 (SMAD7)
   04390 Hippo signaling pathway
    4092 (SMAD7)
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    4092 (SMAD7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
18q21.1
AA seq 425 aa AA seqDB search
MFRTKRSALVRRLWRSRAPGGEDEEEGAGGGGGGGELRGEGATDSRAHGAGGGGPGRAGC
CLGKAVRGAKGHHHPHPPAAGAGAAGGAEADLKALTHSVLKKLKERQLELLLQAVESRGG
TRTACLLLPGRLDCRLGPGAPAGAQPAQPPSSYSLPLLLCKVFRWPDLRHSSEVKRLCCC
ESYGKINPELVCCNPHHLSRLCELESPPPPYSRYPMDFLKPTDCPDAVPSSAETGGTNYL
APGGLSDSQLLLEPGDRSHWCVVAYWEEKTRVGRLYCVQEPSLDIFYDLPQGNGFCLGQL
NSDNKSQLVQKVRSKIGCGIQLTREVDGVWVYNRSSYPIFIKSATLDNPDSRTLLVHKVF
PGFSIKAFDYEKAYSLQRPNDHEFMQQPWTGFTVQISFVKGWGQCYTRQFISSCPCWLEV
IFNSR
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgttcaggaccaaacgatctgcgctcgtccggcgtctctggaggagccgtgcgcccggc
ggcgaggacgaggaggagggcgcagggggaggtggaggaggaggcgagctgcggggagaa
ggggcgacggacagccgagcgcatggggccggtggcggcggcccgggcagggctggatgc
tgcctgggcaaggcggtgcgaggtgccaaaggtcaccaccatccccacccgccagccgcg
ggcgccggcgcggccgggggcgccgaggcggatctgaaggcgctcacgcactcggtgctc
aagaaactgaaggagcggcagctggagctgctgctccaggccgtggagtcccgcggcggg
acgcgcaccgcgtgcctcctgctgcccggccgcctggactgcaggctgggcccgggggcg
cccgccggcgcgcagcctgcgcagccgccctcgtcctactcgctccccctcctgctgtgc
aaagtgttcaggtggccggatctcaggcattcctcggaagtcaagaggctgtgttgctgt
gaatcttacgggaagatcaaccccgagctggtgtgctgcaacccccatcaccttagccga
ctctgcgaactagagtctcccccccctccttactccagatacccgatggattttctcaaa
ccaactgactgtccagatgctgtgccttcctccgctgaaacagggggaacgaattatctg
gcccctggggggctttcagattcccaacttcttctggagcctggggatcggtcacactgg
tgcgtggtggcatactgggaggagaagacgagagtggggaggctctactgtgtccaggag
ccctctctggatatcttctatgatctacctcaggggaatggcttttgcctcggacagctc
aattcggacaacaagagtcagctggtgcagaaggtgcggagcaaaatcggctgcggcatc
cagctgacgcgggaggtggatggtgtgtgggtgtacaaccgcagcagttaccccatcttc
atcaagtccgccacactggacaacccggactccaggacgctgttggtacacaaggtgttc
cccggtttctccatcaaggctttcgactacgagaaggcgtacagcctgcagcggcccaat
gaccacgagtttatgcagcagccgtggacgggctttaccgtgcagatcagctttgtgaag
ggctggggccagtgctacacccgccagttcatcagcagctgcccgtgctggctagaggtc
atcttcaacagccggtag

DBGET integrated database retrieval system