KEGG   Homo sapiens (human): 4099Help
Entry
4099              CDS       T01001                                 

Gene name
MAG, GMA, S-MAG, SIGLEC-4A, SIGLEC4A, SPG75
Definition
(RefSeq) myelin associated glycoprotein
  KO
K06771  
myelin associated glycoprotein
Organism
hsa  Homo sapiens (human)
Pathway
Cell adhesion molecules (CAMs)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    4099 (MAG)
Cell adhesion molecules and their ligands [BR:hsa04516]
 1. Immunoglobulin Superfamily
  Neural system
   N/0 subfamily
    MAG, GMA, SIGLEC4; myelin associated glycoprotein [KO:K06771]
     4099 (MAG)
Lectins [BR:hsa04091]
 I-type lectins (Siglecs)
  4099 (MAG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
Pharos: 
P20916(Tchem)
UniProt: 
Position
19q13.12
AA seq 626 aa AA seqDB search
MIFLTALPLFWIMISASRGGHWGAWMPSSISAFEGTCVSIPCRFDFPDELRPAVVHGVWY
FNSPYPKNYPPVVFKSRTQVVHESFQGRSRLLGDLGLRNCTLLLSNVSPELGGKYYFRGD
LGGYNQYTFSEHSVLDIVNTPNIVVPPEVVAGTEVEVSCMVPDNCPELRPELSWLGHEGL
GEPAVLGRLREDEGTWVQVSLLHFVPTREANGHRLGCQASFPNTTLQFEGYASMDVKYPP
VIVEMNSSVEAIEGSHVSLLCGADSNPPPLLTWMRDGTVLREAVAESLLLELEEVTPAED
GVYACLAENAYGQDNRTVGLSVMYAPWKPTVNGTMVAVEGETVSILCSTQSNPDPILTIF
KEKQILSTVIYESELQLELPAVSPEDDGEYWCVAENQYGQRATAFNLSVEFAPVLLLESH
CAAARDTVQCLCVVKSNPEPSVAFELPSRNVTVNESEREFVYSERSGLVLTSILTLRGQA
QAPPRVICTARNLYGAKSLELPFQGAHRLMWAKIGPVGAVVAFAILIAIVCYITQTRRKK
NVTESPSFSAGDNPPVLFSSDFRISGAPEKYESERRLGSERRLLGLRGEPPELDLSYSHS
DLGKRPTKDSYTLTEELAEYAEIRVK
NT seq 1881 nt NT seq  +upstreamnt  +downstreamnt
atgatattcctcacggcactgcctctgttctggattatgatttcagcctcccgagggggt
cactggggtgcctggatgccctcgtccatctcggccttcgaaggcacgtgcgtctccatc
ccctgccgctttgacttcccggatgagctgcggcccgctgtggtgcatggtgtctggtac
ttcaatagcccctaccccaagaactaccccccggtggtcttcaagtcgcgcacccaagta
gtccacgagagcttccagggccgcagccgcctcctgggggacctgggcctgcgaaactgc
accctcctgctcagcaacgtcagccccgagctgggcgggaagtactacttccgtggggac
ctgggcggctacaaccagtacaccttctcagagcacagcgtcctggatatcgtcaacacc
cccaacatcgtggtgcccccagaggtggtggcaggcacggaggtggaggtcagctgcatg
gtgccggacaactgcccagagctgcgccctgagctgagctggctgggccacgaggggctg
ggggagcccgctgtgctgggccggctgcgggaggacgagggcacctgggtgcaggtgtca
ctgctgcacttcgtgcccacgagggaggccaacggccacaggctgggctgccaggcctcc
ttccccaacaccaccctgcagttcgagggctacgccagcatggacgtcaagtaccccccg
gtgattgtggagatgaactcctcggtggaggccatcgagggctcccacgtgagcctgctc
tgtggggctgacagcaaccccccgccgctgctgacctggatgcgggacgggacagtcctc
cgggaggcggtggccgagagcctgctcctggagctggaggaggtgacccccgccgaagac
ggcgtctatgcctgcctggccgagaatgcctatggccaggacaaccgcaccgtggggctc
agtgtcatgtatgcaccctggaagccaacagtgaacgggacaatggtggccgtagagggg
gagacggtctctatcttgtgctccacacagagcaacccggaccctattctcaccatcttc
aaggagaagcagatcctgtccacggtcatctacgagagcgagctgcagctggagctgccg
gccgtgtcacccgaggatgatggagagtactggtgtgtggctgagaaccagtatggccag
agggccaccgccttcaacctgtctgtggagttcgcccctgtgctcctcctggagtcccac
tgcgcggcagcccgagacacggtgcagtgcctgtgcgtggtgaagtccaacccggagccg
tccgtggcctttgagctgccatcgcgcaatgtgaccgtgaacgagagcgagcgggagttc
gtgtactcggagcgcagcggcctcgtgctcaccagcatcctcacgctgcgggggcaggcc
caggccccgccccgcgtcatctgcaccgcgaggaacctctatggcgccaagagcctggag
ctgcccttccagggagcccatcgactgatgtgggccaagatcgggcctgtgggcgccgtg
gtcgcctttgccatcctgattgccatcgtctgctacattacccagacacgcaggaaaaag
aacgtgacagagagccccagcttctcggcaggggacaaccctcccgtcctgttcagcagc
gacttccgcatctctggggcaccagagaagtacgagagcgagaggcgcctgggatctgag
aggaggctgctgggccttcggggtgagcccccagagctggacctgagctattctcactcg
gacctggggaaacggcccaccaaggacagctacacgctgacggaggagctagctgagtat
gctgaaatccgggtcaagtga

DBGET integrated database retrieval system