KEGG   Homo sapiens (human): 4122Help
Entry
4122              CDS       T01001                                 

Gene name
MAN2A2, MANA2X
Definition
mannosidase, alpha, class 2A, member 2 (EC:3.2.1.114)
Orthology
K01231  
alpha-mannosidase II [EC:3.2.1.114]
Organism
hsa  Homo sapiens (human)
Pathway
N-Glycan biosynthesis
Metabolic pathways
Module
N-glycan biosynthesis, complex type
Class
Metabolism; Glycan biosynthesis and metabolism; N-Glycan biosynthesis [PATH:hsa00510]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
15q26.1
AA seq 1150 aa AA seqDB search
MKLKKQVTVCGAAIFCVAVFSLYLMLDRVQHDPTRHQNGGNFPRSQISVLQNRIEQLEQL
LEENHEIISHIKDSVLELTANAEGPPAMLPYYTVNGSWVVPPEPRPSFFSISPQDCQFAL
GGRGQKPELQMLTVSEELPFDNVDGGVWRQGFDISYDPHDWDAEDLQVFVVPHSHNDPGW
IKTFDKYYTEQTQHILNSMVSKLQEDPRRRFLWAEVSFFAKWWDNINVQKRAAVRRLVGN
GQLEIATGGWVMPDEANSHYFALIDQLIEGHQWLERNLGATPRSGWAVDPFGYSSTMPYL
LRRANLTSMLIQRVHYAIKKHFAATHSLEFMWRQTWDSDSSTDIFCHMMPFYSYDVPHTC
GPDPKICCQFDFKRLPGGRINCPWKVPPRAITEANVAERAALLLDQYRKKSQLFRSNVLL
VPLGDDFRYDKPQEWDAQFFNYQRLFDFFNSRPNLHVQAQFGTLSDYFDALYKRTGVEPG
ARPPGFPVLSGDFFSYADREDHYWTGYYTSRPFYKSLDRVLEAHLRGAEVLYSLAAAHAR
RSGLAGRYPLSDFTLLTEARRTLGLFQHHDAITGTAKEAVVVDYGVRLLRSLVNLKQVII
HAAHYLVLGDKETYHFDPEAPFLQVDDTRLSHDALPERTVIQLDSSPRFVVLFNPLEQER
FSMVSLLVNSPRVRVLSEEGQPLAVQISAHWSSATEAVPDVYQVSVPVRLPALGLGVLQL
QLGLDGHRTLPSSVRIYLHGRQLSVSRHEAFPLRVIDSGTSDFALSNRYMQVWFSGLTGL
LKSIRRVDEEHEQQVDMQVLVYGTRTSKDKSGAYLFLPDGEAKPYVPKEPPVLRVTEGPF
FSEVVAYYEHIHQAVRLYNLPGVEGLSLDISSLVDIRDYVNKELALHIHTDIDSQGIFFT
DLNGFQVQPRRYLKKLPLQANFYPMPVMAYIQDAQKRLTLHTAQALGVSSLKDGQLEVIL
DRRLMQDDNRGLGQGLKDNKRTCNRFRLLLERRTVGSEVQDSHSTSYPSLLSHLTSMYLN
APALALPVARMQLPGPGLRSFHPLASSLPCDFHLLNLRTLQAEEDTLPSAETALILHRKG
FDCGLEAKNLGFNCTTSQGKVALGSLFHGLDVVFLQPTSLTLLYPLASPSNSTDVYLEPM
EIATFRLRLG
NT seq 3453 nt NT seq  +upstreamnt  +downstreamnt
atgaagctgaaaaagcaggtgacagtgtgtggggctgccatcttctgtgtggcagtcttc
tcgctctacctcatgctggaccgagtgcaacacgatcccacccgacaccagaatggtggg
aacttcccccggagccaaatttctgtgctgcagaaccgcattgagcagctggagcagctt
ttggaggagaaccatgagattatcagccatatcaaggactccgtgctggagctgacagcc
aacgcagagggcccgcccgccatgctgccctactacacggtcaatggctcctgggtggtg
ccaccggagccccggcccagcttcttctccatctccccgcaggactgccagtttgctttg
gggggccggggtcagaagccagagctgcagatgctcactgtgtcggaggagctgccgttt
gacaacgtggatggtggtgtgtggaggcaaggcttcgacatctcctacgacccgcacgac
tgggatgctgaagacctgcaggtgtttgtggtgccccactctcacaatgacccaggctgg
atcaagacctttgacaagtactacacagagcagacccaacacatcctcaatagcatggtg
tctaagctgcaggaggacccccggcggcgcttcctctgggcagaggtctccttcttcgcc
aagtggtgggacaacatcaatgtccaaaagagagcggcagtccgaaggctggtgggaaac
gggcagctggagattgcgacaggaggctgggtgatgccagatgaggccaattcccactac
tttgcattgattgaccagctcatcgaaggacaccagtggctggagagaaatcttggtgca
accccccgctctggctgggcagtggacccctttggatacagctccaccatgccttacctg
ctgcgccgtgccaacctcaccagcatgctgattcagagagtgcactatgccatcaagaag
cactttgctgccacccacagcctagagttcatgtggaggcagacatgggactcggactcc
agcacagacatcttctgtcacatgatgcccttctacagctatgacgtcccccatacctgt
ggcccagatcccaagatctgctgccaatttgatttcaaacgcctgcctggtgggcgcatc
aactgcccttggaaggtgccaccccgggccatcacagaggccaacgtggcagagagggca
gccctgcttctggaccaataccggaagaagtcccagctgttccgaagcaacgtcctcctg
gtgcctcttggagatgacttccgatatgacaagccccaggagtgggatgcccagttcttc
aactaccaacggctctttgacttcttcaacagcaggcctaacctccatgtgcaggcccag
tttggcactctttctgactattttgatgccctgtacaagaggacaggggtggagccaggg
gcccggcctccagggtttcctgtgctgagcggggatttcttctcctatgcggaccgggag
gatcattactggacaggctattacacttcccggcccttctacaagagcttagaccgagtc
ctggaagcccacctgcggggggcagaggttctgtacagcctggctgcagctcacgctcgc
cgctctggtctggctggccggtacccactgtctgatttcaccctcctgacggaagctcgg
cgcacattggggctcttccagcatcacgatgccatcactggcacggccaaggaggctgtg
gtggtggactatggggtcaggcttctgcgctcccttgtcaacctgaagcaggtcatcatt
catgcagcccactatctggtgctgggggacaaggagacctaccactttgaccctgaggcg
cccttcctccaagtggatgacactcgcttaagtcacgacgccctcccagagcgcacggtg
atccagctggattcctcgcccaggtttgtggtcctattcaacccactggaacaggagcga
ttcagcatggtgtccctgctggtcaactctccccgcgtgcgtgtcctttcggaggagggt
cagcccctggccgtgcagatcagcgcacactggagctctgccaccgaggcggtccctgac
gtctaccaggtgtctgtgcctgtccgcctgccagccctgggcctgggcgtgctgcagcta
cagctgggcctggatgggcaccgcacgctgccctcctctgtgcgcatctacctgcacggc
cggcagctgtccgtcagcaggcacgaagcgtttcctctccgtgtcattgactctggcacc
agcgacttcgccctcagcaaccgctacatgcaggtctggttctcaggccttactgggctc
ctcaagagcatccgaagggtggatgaggagcacgagcagcaggtggacatgcaggtcctt
gtctatggcacccgtacgtccaaagacaagagtggagcctacctcttcctgcccgatggc
gaggccaagccctacgtccccaaggagccccccgtgctgcgtgtcactgaaggccctttc
ttctcagaggtggttgcgtactatgagcacattcaccaggcggtccggctttacaatctg
ccaggggtggaggggctgtctctggacatatcatccctggtggacatccgggactacgtc
aacaaggagctggccctgcacatccatacagacatcgacagccagggtatcttcttcaca
gacctcaatggctttcaggtgcagccccgacggtatctgaagaagctccccctccaggcc
aacttctaccccatgccagtcatggcctatatccaggacgcacagaagcgcctcacgctg
cacactgcccaggccctgggtgtctctagcctcaaagatggccagctggaggtgatcttg
gaccggcggctgatgcaggatgacaaccggggcctaggccaagggctcaaggacaacaag
agaacctgcaaccgtttccgcctcctgctagagcggcgaaccgtgggcagtgaggtccaa
gatagccactctaccagctacccatccctcctcagccacctgacctccatgtacctgaac
gccccggcgctcgctctgcctgtagccaggatgcagctcccaggccctggtctgcgctca
tttcatcctctggcttcctcactgccctgtgacttccacctgctcaacctacgtacgctc
caggctgaggaggacaccctaccctcggcggagaccgcactcatcttacaccgcaagggt
tttgactgcggcctggaggccaagaacttgggcttcaactgcaccacaagccaaggcaag
gtagccctgggcagccttttccatggcctggatgtggtattccttcagccaacctccttg
acgttactgtaccctctggcctccccgtccaacagcactgacgtctatttggagcccatg
gagattgctacctttcgcctccgcttgggttag

DBGET integrated database retrieval system